Property Summary

NCBI Gene PubMed Count 75
Grant Count 43
R01 Count 18
Funding $2,922,668.69
PubMed Score 16.84
PubTator Score 42.85

Knowledge Summary

Patent

No data available

Expression

Gene RIF (41)

PMID Text
26997484 Kv3.3 regulates Arp2/3-dependent cortical actin nucleation mediated by Hax-1; resulting cortical actin structures interact with the channel's gating machinery to slow its inactivation rate during sustained membrane depolarizations; a mutation that leads to late-onset spinocerebellar ataxia type 13.
26655834 demonstrate that the Arp2/3 complex in higher eukaryotes is actually a family of complexes with different properties
26370503 Suggest alpha5beta1/Arp2/Arp3/FHOD3 pathway reprograms the actin cytoskeleton to promote invasive migration and local invasion in vivo.
26028144 Platelet actin nodule formation is dependent on WASp and the ARP2/3 complex.
26018170 HIV-1 Gag is required by RAC1-WASF2-BAIAP2-ARP3 pathway for HIV VLP production/release from Jurkat T lymphocytes
26018170 HIV-1 VLP production/release from Jurkat T lymphocytes requires an intact RAC1-WASF2-BAIAP2-ARP3 pathway as demonstrated by siRNA knockdown experiments
25264243 The loss of the Arp2/3 complex acts as a stress that initiates cell cycle arrest by triggering p16INK4a/p14Arf transcription.
24872192 study unveils an ARP2/3:VCA-independent function of nuclear-WASp in TH1 gene activation that is uncoupled from its cytoplasmic role in actin polymerization.
24469447 Cortactin has a role as a scaffold for Arp2/3 and WAVE2 at the epithelial zonula adherens
24415754 HIV-1 VLP production/release from Jurkat T lymphocytes requires an intact RAC1-WASF2-BAIAP2-ARP3 pathway as demonstrated by siRNA knockdown experiments
More...

AA Sequence

MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKP      1 - 70
TYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLY     71 - 140
IAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRD    141 - 210
REVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPE    211 - 280
IFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLS    281 - 350
EELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS      351 - 418
//

Text Mined References (84)

PMID Year Title
26997484 2016 Kv3.3 Channels Bind Hax-1 and Arp2/3 to Assemble a Stable Local Actin Network that Regulates Channel Gating.
26655834 2016 Isoform diversity in the Arp2/3 complex determines actin filament dynamics.
26370503 2015 ?5?1 integrin recycling promotes Arp2/3-independent cancer cell invasion via the formin FHOD3.
26028144 2015 Platelet actin nodules are podosome-like structures dependent on Wiskott-Aldrich syndrome protein and ARP2/3 complex.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25264243 2014 Divide and conquer: the surprising link between motility and the cell cycle (retrospective on DOI 10.1002/bies.201200119).
24872192 2014 Nuclear role of WASp in gene transcription is uncoupled from its ARP2/3-dependent cytoplasmic role in actin polymerization.
24469447 2014 Cortactin scaffolds Arp2/3 and WAVE2 at the epithelial zonula adherens.
24344184 2013 Loss of Arp2/3 induces an NF-?B-dependent, nonautonomous effect on chemotactic signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...