Property Summary

NCBI Gene PubMed Count 81
PubMed Score 17.66
PubTator Score 42.85

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (11)

Gene RIF (47)

AA Sequence

MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKP      1 - 70
TYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLY     71 - 140
IAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRD    141 - 210
REVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPE    211 - 280
IFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLS    281 - 350
EELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS      351 - 418
//

Text Mined References (90)

PMID Year Title