Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
tuberculosis 2010 6.4e-07
ovarian cancer 8520 2.9e-06
glioblastoma 5792 2.1e-05
atypical teratoid / rhabdoid tumor 5112 1.0e-04
osteosarcoma 7950 1.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Myelomeningocele 16 4.932 2.5

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 1.0e-04
glioblastoma -1.200 2.1e-05
osteosarcoma -1.202 1.1e-04
ovarian cancer -1.300 2.9e-06
tuberculosis -1.300 6.4e-07

Synonym

Accession P61129 A9JR71 Q6ZW96
Symbols ZC3HDC6

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MTDSEHAGHDREDGELEDGEIDDAGFEEIQEKEAKENEKQKSEKAYRKSRKKHKKEREKKKSKRRKREKH      1 - 70
KHNSPSSDDSSDYSLDSDVEHTESSHKKRTGFYRDYDIPFTQRGHISGSYITSKKGQHNKKFKSKEYDEY     71 - 140
STYSDDNFGNYSDDNFGNYGQETEEDFANQLKQYRQAKETSNIALGSSFSKESGKKQRMKGVQQGIEQRV    141 - 210
KSFNVGRGRGLPKKIKRKERGGRTNKGPNVFSVSDDFQEYNKPGKKWKVMTQEFINQHTVEHKGKQICKY    211 - 280
FLEGRCIKGDQCKFDHDAELEKRKEICKFYLQGYCTKGENCIYMHNEFPCKFYHSGAKCYQGDNCKFSHD    281 - 350
DLTKETKKLLDKVLNTDEELINEDERELEELRKRGITPLPKPPPGVGLLPTPPEHFPFSDPEDDFQTDFS    351 - 420
DDFRKIPSLFEIVVKPTVDLAHKIGRKPPAFYTSASPPGPQFQGSSPHPQHIYSSGSSPGPGPNMSQGHS    421 - 490
SPVMHPGSPGHHPCAGPPGLPVPQSPPLPPGPPEIVGPQNQAGVLVQPDTSLTPPSMGGAYHSPGFPGHV    491 - 560
MKVPRENHCSPGSSYQQSPGEMQLNTNYESLQNPAEFYDNYYAQHSIHNFQPPNNSGDGMWHGEFAQQQP    561 - 630
PVVQDSPNHGSGSDGSSTRTGHGPLPVPGLLPAVQRALFVRLTQRYQEDEEQTSTQPHRAPSKEEDDTVN    631 - 700
WYSSSEEEEGSSVKSILKTLQKQTETLRNQQQPSTELSTPTDPRLAKEKSKGNQVVDPRLRTIPRQDIRK    701 - 770
PSESAPLDLRLAWDPRKLRGNGSGHIGSSVGGAKFDLHHANAGTNVKHKRGDDDDEDTERELREKAFLIP    771 - 840
LDASPGIMLQDPRSQLRQFSHIKMDITLTKPNFAKHIVWAPEDLLPVPLPKPDPVSSINLPLPPLIADQR    841 - 910
LNRLWNTKSDLHQNTVSIDPKLAAKAKINTTNREGYLEQFGDSHGSGAKLGDPRLQKNFDPRLHRLPNTE    911 - 980
SHQVVMKDSHASKGAPHLPRSNPGSSQPSGAGTSNSGSGALPPYAPKLSSSAGLPLGTSTSVLSGISLYD    981 - 1050
PRDHGSSSTSELATASSGENSKNQKKSGGLKSSDKTEPSPGEAILPQKPSPNVGVTLEGPADPQADVPRS   1051 - 1120
SGKVQVPAVHSLPVQALTGLIRPQYSDPRQARQPGQGSPTPDNDPGRETDDKSLKEVFKTFDPTASPFC    1121 - 1189
//

Text Mined References (7)

PMID Year Title