Property Summary

NCBI Gene PubMed Count 49
PubMed Score 30.47
PubTator Score 30.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 1.100 1.1e-02
atypical teratoid / rhabdoid tumor -1.100 2.1e-04
colon cancer -1.100 3.0e-02
intraductal papillary-mucinous adenoma (... 1.200 1.9e-04
intraductal papillary-mucinous carcinoma... 1.100 8.9e-04
medulloblastoma, large-cell -1.100 7.2e-04
Multiple myeloma 1.078 3.2e-04
osteosarcoma 1.036 3.1e-03
ovarian cancer -2.100 7.7e-07
Pick disease 1.200 1.3e-04
psoriasis -1.100 1.6e-03
sonic hedgehog group medulloblastoma -1.200 3.8e-04

Gene RIF (18)

AA Sequence

MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQ      1 - 70
ERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAK     71 - 140
QFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQR    141 - 210
EGCGC                                                                     211 - 215
//

Text Mined References (56)

PMID Year Title