Property Summary

NCBI Gene PubMed Count 46
Grant Count 29
R01 Count 23
Funding $3,363,267.15
PubMed Score 28.17
PubTator Score 30.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (15)

PMID Text
26032412 We find that Rab14 indeed binds to RCP, albeit with reduced affinity relative to conventional Rab11-FIP and Rab25-FIP complexes. However, in vivo, Rab11 recruits RCP onto biological membranes.
25694446 PKCiota binds to Rab14 and that PKCiota requires Rab14 for its correct distribution in cells. As with Rab14, PKCiota protects claudin-2 from lysosomal degradation and, in consequence, modulates epithelial barrier.
25312678 RAB14 is a direct target of both MIR144 and MIR451. As MIR144 and MIR451 expression increased during human erythropoiesis, RAB14 protein expression decreased. RAB14 as a novel physiological inhibitor of human erythropoiesis.
25201065 the miR-451/RAB14 interaction plays an important role in the enhancement of radiosensitivity in NPC cells.
24006491 Data indicate that myosin Va interacted with multiple new Rab subfamilies including Rab6, Rab14 and Rab39B.
23615442 Data indicate taht the parasitophorous vacuole (PV), marked with Rab14, Rab30, or Rab43, colocalize with host-derived sphingolipids in the vacuolar space.
23606746 Rab5a, Rab8a and Rab14 are major regulators of MT1-MMP trafficking and invasive migration of primary human macrophages.
23592992 findings support a model for HIV-1 Env incorporation in which specific targeting to the particle assembly microdomain on the plasma membrane is mediated by FIP1C and Rab14
23592992 The interaction of RAB11-FIP1C with RAB14 is required for incorporation of HIV-1 Env (gp120/gp41) into virions
23592992 The interaction of RAB11-FIP1C with RAB14 is required for incorporation of HIV-1 Env (gp120/gp41) into virions
More...

AA Sequence

MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQ      1 - 70
ERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAK     71 - 140
QFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQR    141 - 210
EGCGC                                                                     211 - 215
//

Text Mined References (53)

PMID Year Title
26032412 2015 Structure-Function Analyses of the Interactions between Rab11 and Rab14 Small GTPases with Their Shared Effector Rab Coupling Protein (RCP).
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25694446 2015 PKC? interacts with Rab14 and modulates epithelial barrier function through regulation of claudin-2 levels.
25416956 2014 A proteome-scale map of the human interactome network.
25312678 2015 MIR144 and MIR451 regulate human erythropoiesis via RAB14.
25201065 2014 MiR-451 increases radiosensitivity of nasopharyngeal carcinoma cells by targeting ras-related protein 14 (RAB14).
24006491 2013 Identification and characterization of multiple novel Rab-myosin Va interactions.
23615442 2013 Toxoplasma gondii salvages sphingolipids from the host Golgi through the rerouting of selected Rab vesicles to the parasitophorous vacuole.
23606746 2013 A specific subset of RabGTPases controls cell surface exposure of MT1-MMP, extracellular matrix degradation and three-dimensional invasion of macrophages.
23592992 2013 Rab11-FIP1C and Rab14 direct plasma membrane sorting and particle incorporation of the HIV-1 envelope glycoprotein complex.
More...