Property Summary

NCBI Gene PubMed Count 74
Grant Count 42
R01 Count 29
Funding $2,180,506.61
PubMed Score 98.95
PubTator Score 82.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.057 0.011
astrocytic glioma -1.400 0.016
ependymoma -1.200 0.050
oligodendroglioma -1.200 0.040
psoriasis 1.300 0.000
osteosarcoma 2.556 0.000
lung cancer 1.200 0.001
subependymal giant cell astrocytoma -1.098 0.045
Pick disease -1.200 0.002
invasive ductal carcinoma 1.300 0.001
ovarian cancer 1.600 0.000
pituitary cancer 1.300 0.000

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
1552 other 7 / 0 / 3670 NMR assay targeting the ubiquitin-proteasome system to modulate protein folding and degradation
2658 confirmatory 30 / 0 / 84 SAR analysis of Ubc13-Ubiquitination selectivity in a TR-FRET assay for In Vitro dose response studies
485273 screening 1540 / 870 / 328071 uHTS identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay
485343 summary 0 / 0 / 0 Summary of small molecule inhibitors of UBC13 Polyubiquitin
485351 confirmatory 38 / 0 / 50 SAR analysis of Ubc13-Ubiquitination selectivity in a TR-FRET assay for In Vitro dose response studies - set 2
488859 screening 970 / 74 / 386 Single concentration confirmation of uHTS for the identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay
493155 confirmatory 354 / 0 / 856 Dose Response confirmation of uHTS for the identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay
493182 confirmatory 296 / 0 / 57 Dose Response confirmation of uHTS for the identification of UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay reconfirm
504687 confirmatory 104 / 0 / 25 SAR analysis of small molecule UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay
588390 confirmatory 9 / 0 / 18 SAR analysis of small molecule UBC13 Polyubiquitin Inhibitors via a TR-FRET Assay - Set 2
More...

Gene RIF (37)

PMID Text
26546463 The malin-laforin complex interacts physically and functionally with the ubiquitin conjugating enzyme E2-N (UBE2N).
26148049 Data suggest that ubiquitin-conjugating enzyme E2 variant 2 (Ube2V2) and ring finger protein 4 (RNF4) together induce an active conformation of the ubiquitin-conjugating enzyme Ubc13-ubiquitin (Ubc13~Ub) thioester.
25476932 MiR-205 inhibits DNA damage repair by targeting ZEB1 and Ubc13.
25189770 Ubc13 was dispensable for transforming growth factor beta (TGFbeta)-induced SMAD activation but was required for activation of non-SMAD signaling via TGFbeta-activating kinase 1 (TAK1) and p38
25022892 Ubiquitin-conjugating enzyme complex Uev1A-Ubc13 promotes breast cancer metastasis through nuclear factor-small ka, CyrillicB mediated matrix metalloproteinase-1 gene regulation.
24906799 together with UBE2L3 and UBE2D2, synergistically contribute to Parkin-mediated mitophagy
24610393 overexpression of hsa-miR-4516 downregulates STAT3, p-STAT3, CDK6, and UBE2N proteins that are consistently upregulated in psoriasis and induces apoptosis in HaCaT cells.
24556694 UBE2N inhibition induces neuroblastoma apoptotic cell death via activation of p53 and JNK pathways.
23633953 crystal structure of the Shigella flexneri OspI-Ubc13 complex at 2.3 A resolution; study reveals the molecular basis of Ubc13 deamidation by OspI, as well as a convergence of E2 recognition by bacterial and host proteins
23542009 The structure of the Shigella flexneri OspI and human Ubc13 complex revealed that the interacting surfaces between OspI and Ubc13 are a hydrophobic surface and a complementary charged surface.
More...

AA Sequence

MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVR      1 - 70
FMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETA     71 - 140
RAWTRLYAMNNI                                                              141 - 152
//

Text Mined References (85)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26546463 2015 Ubiquitin conjugating enzyme E2-N and sequestosome-1 (p62) are components of the ubiquitination process mediated by the malin-laforin E3-ubiquitin ligase complex.
26148049 2015 Structural basis for the RING-catalyzed synthesis of K63-linked ubiquitin chains.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25936802 2015 The ubiquitination of rag A GTPase by RNF152 negatively regulates mTORC1 activation.
25476932 2014 miR-205 acts as a tumour radiosensitizer by targeting ZEB1 and Ubc13.
25260751 2014 The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines.
25189770 2014 Ubiquitin-conjugating enzyme Ubc13 controls breast cancer metastasis through a TAK1-p38 MAP kinase cascade.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
25022892 2014 Ubiquitin-conjugating enzyme complex Uev1A-Ubc13 promotes breast cancer metastasis through nuclear factor-?B mediated matrix metalloproteinase-1 gene regulation.
More...