Property Summary

NCBI Gene PubMed Count 81
PubMed Score 107.80
PubTator Score 82.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Embryo Loss 7 0.0 0.0
Disease Target Count Z-score Confidence
Cancer 2499 3.143 1.6

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.400 1.6e-02
ependymoma -1.200 5.0e-02
invasive ductal carcinoma 1.300 1.5e-03
lung cancer 1.200 6.2e-04
oligodendroglioma -1.200 4.0e-02
osteosarcoma 2.556 1.2e-05
ovarian cancer -1.100 4.5e-03
Pick disease -1.200 1.8e-03
pituitary cancer 1.300 1.1e-05
psoriasis 1.300 3.1e-07
subependymal giant cell astrocytoma -1.098 4.5e-02
Waldenstrons macroglobulinemia 1.057 1.1e-02

Protein-protein Interaction (2)

Gene RIF (37)

AA Sequence

MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVR      1 - 70
FMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETA     71 - 140
RAWTRLYAMNNI                                                              141 - 152
//

Text Mined References (88)

PMID Year Title