Property Summary

NCBI Gene PubMed Count 36
Grant Count 237
R01 Count 163
Funding $26,947,866.57
PubMed Score 146.60
PubTator Score 187.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.032 0.004
astrocytic glioma -1.400 0.020
ependymoma -1.400 0.037
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.400 0.000
acute quadriplegic myopathy 1.086 0.000
lung cancer 1.500 0.001
adult high grade glioma -1.300 0.002
subependymal giant cell astrocytoma -1.246 0.010
ovarian cancer 2.100 0.000

Synonym

Accession P61086 A6NJC1 A8K5Y9 B2RDF8 C9JGP1 O54806 P27924 Q16721 Q9CVV9 Q9Y2D3
Symbols LIG
HIP2
HYPG
UBC1
E2-25K

Gene

PDB

2O25   5DFL   3K9O   3K9P   1YLA   3E46   3F92  

Gene RIF (8)

PMID Text
26592444 The crystal structure of a Ube2K~ubiquitin conjugate has been described, and it was shown that even though it is monomeric, Ube2K can synthesize Lys48-linked ubiquitin chains.
23933584 Hip2, a ubiquitin-conjugating enzyme, can overcome radiation-induced G2/M cell cycle arrest and trigger the entry into mitosis.
22164771 An extract of bark from the tropical rainforest plant Byrsonima crassifolia was screened for inhibition of diubiquitin formation by the human ubiquitin-conjugating enzyme E2-25K.
21281599 one of the roles of the C-terminal UBA domain, in the context of E2-25K, is to increase processivity in Lys48-linked polyubiquitin chain synthesis, possibly through increased binding to the ubiquitinated substrate.
20826778 Results suggest that the interaction between E2-25K and UBB(+1) is critical for the synthesis and accumulation of UBB(+1)-anchored polyubiquitin, which results in proteasomal inhibition and neuronal cell death.
20537984 This study suggests that Hip2 might be involved in the regulation of Smac-mediated apoptosis.
17092742 E2-25K is involved in aggregate formation of expanded polyglutamine proteins and polyglutamine-induced cell death.
16868077 Results suggest that in permeabilized, US11-expressing cells polyubiquitination of the MHC class I heavy chain substrate can be catalyzed by E2-25K.

AA Sequence

MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNP      1 - 70
PKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEM     71 - 140
FKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATELLLSN              141 - 200
//

Text Mined References (47)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26592444 2015 The molecular basis of lysine 48 ubiquitin chain synthesis by Ube2K.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24882218 2014 Unanchored K48-linked polyubiquitin synthesized by the E3-ubiquitin ligase TRIM6 stimulates the interferon-IKK? kinase-mediated antiviral response.
24535457 2014 A genome-wide association meta-analysis of plasma A? peptides concentrations in the elderly.
24446487 2014 E2~Ub conjugates regulate the kinase activity of Shigella effector OspG during pathogenesis.
23933584 2013 Hip2 ubiquitin-conjugating enzyme overcomes radiation-induced G2/M arrest.
More...