Property Summary

NCBI Gene PubMed Count 30
PubMed Score 16.38
PubTator Score 19.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.8e-04
osteosarcoma 7950 1.1e-03
astrocytoma 1146 2.6e-03
Multiple myeloma 1332 3.0e-03
dermatomyositis 966 4.5e-03
lung cancer 4740 8.6e-03
glioblastoma 5792 1.2e-02
oligodendroglioma 2850 5.0e-02

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma -1.800 2.6e-03
dermatomyositis -1.300 4.5e-03
glioblastoma -1.400 1.2e-02
lung cancer 1.500 8.6e-03
Multiple myeloma 1.031 3.0e-03
oligodendroglioma -1.200 5.0e-02
osteosarcoma 1.188 1.1e-03
psoriasis 1.400 1.8e-04

Gene RIF (8)

AA Sequence

MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGF      1 - 70
YKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPN     71 - 140
PEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK                               141 - 183
//

Text Mined References (36)

PMID Year Title