Property Summary

NCBI Gene PubMed Count 27
Grant Count 6
Funding $135,188.49
PubMed Score 14.61
PubTator Score 19.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.031 0.003
oligodendroglioma -1.200 0.050
psoriasis 1.400 0.000
osteosarcoma 1.188 0.001
astrocytoma -1.800 0.003
glioblastoma -1.400 0.012
lung cancer 1.500 0.009
dermatomyositis -1.300 0.005

Synonym

Accession P61081 O76069 Q8VC50
Symbols UBC12
hUbc12
UBC-RS2

Gene

PDB

3TDU   3TDZ   4P5O   1TT5   2NVU   1Y8X   4GAO  

Gene RIF (7)

PMID Text
26206335 Polymorphisms in the UBE2M gene are associated with cetuximab efficacy in colorectal cancer.
25229838 E1 (NAE1 and UBA3) and E2 (UBC12) enzymes, as well as global NEDD8 conjugation, were upregulated in over 2/3 of human intrahepatic cholangiocarcinoma
25025768 UBE2M is required to maintain genome integrity by activating multiple Cullin ligases throughout the cell cycle.
23201271 Distinct preferences of UBC12 and UBE2F peptides for inhibiting different DCNLs, including the oncogenic DCNL1.
21477582 Our results demonstrate a role for UBE2M in mediating cytotoxicity of gemcitabine in human urothelial carcinoma cells.
18826954 SCCRO recruits Ubc12 approximately NEDD8 to the CAND1-Cul1-ROC1 complex but that this is not sufficient to dissociate or overcome the inhibitory effects of CAND1 on cullin neddylation
15694336 crystal structure of a complex between the C-terminal domain from NEDD8's heterodimeric E1 (APPBP1-UBA3) and the catalytic core domain of NEDD8's E2 (Ubc12)

AA Sequence

MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGF      1 - 70
YKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPN     71 - 140
PEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK                               141 - 183
//

Text Mined References (33)

PMID Year Title
26206335 2015 Polymorphisms in Genes Involved in EGFR Turnover Are Predictive for Cetuximab Efficacy in Colorectal Cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25229838 2014 Neddylation pathway is up-regulated in human intrahepatic cholangiocarcinoma and serves as a potential therapeutic target.
25025768 2014 Inactivating UBE2M impacts the DNA damage response and genome integrity involving multiple cullin ligases.
24949976 2014 Structure of a RING E3 trapped in action reveals ligation mechanism for the ubiquitin-like protein NEDD8.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23201271 2013 Structural conservation of distinctive N-terminal acetylation-dependent interactions across a family of mammalian NEDD8 ligation enzymes.
21940857 2011 N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.
More...