Property Summary

NCBI Gene PubMed Count 56
PubMed Score 19.99
PubTator Score 24.50

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (18)

AA Sequence

MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT      1 - 70
TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISRE     71 - 140
WTQKYAM                                                                   141 - 147
//

Text Mined References (70)

PMID Year Title