Property Summary

NCBI Gene PubMed Count 54
Grant Count 6
R01 Count 2
Funding $112,398
PubMed Score 18.03
PubTator Score 24.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P61077 A6NJ93 A6NJB1 A6NM99 P47986 Q6IB88 Q6NXS4 Q8N924
Symbols UBC4/5
UBCH5C
E2(17)KB3

Gene

PANTHER Protein Class (1)

PDB

5IFR   2FUH   3UGB   4BVU   1X23   3L1Z   3RPG   4R8P   4S3O  

Gene RIF (17)

PMID Text
26502057 Data show that ubiquitin E2 enzymes UBE2D1/2/3 and E3 ligase RNF138 accumulate at DNA-damage sites and act at early resection stages by promoting CtIP protein ubiquitylation and accrual.
24446487 UbcH5c~Ubiqitin binding stabilizes an active conformation of the Shigella flexneri OspG kinase, greatly enhancing its activity.
24403071 These data reveal novel insights into the Otub1 inhibition of E2 wherein monoubiquitination promotes the interaction of Otub1 with UbcH5 and the function to suppress it.
24296361 This study demonistrated by Gene expression profile that UBE3D3 upregulaion in fibroblasts of Huntington's disease patients.
23741361 UBE2D3 participates in the process of radiosensitivity in human breast cancer cells by regulating TERT and cyclin D1.
23550736 although a reduction in interdomain dynamics of UbcH5c~Ub is observed upon binding to E4B, Ub retains an extensive degree of flexibility
21772249 The crystal structure of a complex of the Bmi1/Ring1b RING-RING heterodimer & UbcH5c shows that UbcH5c interacts with Ring1b only.
21226485 UbcH5c approximately Ub conjugate populates an array of extended conformations, and the population of Ubc13 approximately Ub conjugates favors a closed conformation in which the hydrophobic surface of Ub faces helix 2 of Ubc13
20860768 Observational study of gene-disease association. (HuGE Navigator)
20696396 determined structures of E4B U box free and bound to UbcH5c and Ubc4 E2s; findings show E4B U box is a monomer stabilized by a network of hydrogen bonds; findings suggest allosteric regulation of UbcH5c and Ubc4 by E4B U box
More...

AA Sequence

MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT      1 - 70
TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISRE     71 - 140
WTQKYAM                                                                   141 - 147
//

Text Mined References (68)

PMID Year Title
26752685 2016 FIH Regulates Cellular Metabolism through Hydroxylation of the Deubiquitinase OTUB1.
26502057 2015 Systematic E2 screening reveals a UBE2D-RNF138-CtIP axis promoting DNA repair.
25416956 2014 A proteome-scale map of the human interactome network.
24446487 2014 E2~Ub conjugates regulate the kinase activity of Shigella effector OspG during pathogenesis.
24403071 2014 Monoubiquitination is critical for ovarian tumor domain-containing ubiquitin aldehyde binding protein 1 (Otub1) to suppress UbcH5 enzyme and stabilize p53 protein.
24296361 2014 Gene expression profile in fibroblasts of Huntington's disease patients and controls.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23741361 2013 Inhibition of UBE2D3 expression attenuates radiosensitivity of MCF-7 human breast cancer cells by increasing hTERT expression and activity.
23550736 2013 Activation of UbcH5c~Ub is the result of a shift in interdomain motions of the conjugate bound to U-box E3 ligase E4B.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...