Property Summary

NCBI Gene PubMed Count 60
Grant Count 59
R01 Count 49
Funding $4,049,397.5
PubMed Score 60.27
PubTator Score 45.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cancer 2,346 3.907 2.0

Expression

Synonym

Accession P61024 P33551 CKS-1
Symbols CKS1
ckshs1
PNAS-16
PNAS-18

Gene

PANTHER Protein Class (2)

PDB

2ASS   2AST   1BUH   1DKS   1DKT   4YC6  

Gene RIF (38)

PMID Text
26531156 Results show that Cks1 and Cks2 promoted proliferation and prevented apoptosis of hepatocellular carcinoma HepG2 cells.
25544127 We conclude that perturbing the Hsp90 pathway could provide a useful therapeutic strategy in tumors driven by Cks1 overexpression
25353373 Regulation of Cks1 protein stability is crucially dependent on specific tyrosine and lysine residues which are potential sites for post-translational modifications.
24973170 Our results suggest a role for CKS1B in the multiple step process of progression of MGUS to MM and show that CKS1B copy gain has a more significant prognostic value than its overexpression.
24574749 EGF upregulates the mRNA and protein levels of Skp2/Cks1 and p27(kip1) via the PI3K/Akt pathway and direct binding of E2F1 transcription factor with the Skp2 promoter in extrahepatic cholangiocarcinoma cells.
24205826 Specifically, CKS1B and MAP2K5 significantly inhibited hepatitis C viral RNA replication. PACSIN1, by contrast, inhibited hepatitis C virus infection by decreasing the level of viral protein p7.
24169086 Anaplastic multiple myeloma was associated with significantly higher prevalence of CKS1B amplification than non-anaplastic multiple myeloma.
23879533 We demonstrated that high expression of CKS1B immunostaining can be one potent prognostic factor for disease-specific survival, metastasis-free survival, and local recurrence-free survival in patients with nasopharyngeal carcinoma.
23301842 CKS1 mRNA and protein expression were increased in esophageal carcinoma. Overexpression of CKS1 was associated with higher grad, regional lymph node invasion, and neoplastic embolus. CKS1 was negatively associated with the p27(kip1) level in the tumor.
22302047 Cks1 is overexpressed in esophageal squamous cell carcinoma tissues. Overexpression correlates with increased radiotherapy resistance of esophageal squamous cell carcinoma.
More...

AA Sequence

MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR      1 - 70
RPLPKKPKK                                                                  71 - 79
//

Text Mined References (62)

PMID Year Title
26531156 2016 Depletion of Cks1 and Cks2 expression compromises cell proliferation and enhance chemotherapy-induced apoptosis in HepG2 cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25544127 2015 Cks1 proteasomal degradation is induced by inhibiting Hsp90-mediated chaperoning in cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
25353373 2015 Cks1 proteasomal turnover is a predominant mode of regulation in breast cancer cells: role of key tyrosines and lysines.
24973170 2014 Quantitative analysis of CKS1B mRNA expression and copy number gain in patients with plasma cell disorders.
24574749 2014 Epidermal growth factor upregulates Skp2/Cks1 and p27(kip1) in human extrahepatic cholangiocarcinoma cells.
24205826 2014 Identification of novel human kinases that suppress hepatitis C virus infection.
24169086 2013 Genomic aberrations in anaplastic multiple myeloma: high frequency of 1q21(CKS1B) amplifications.
More...