Property Summary

NCBI Gene PubMed Count 65
PubMed Score 63.83
PubTator Score 45.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 3.947 2.0

Expression

Gene RIF (43)

AA Sequence

MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR      1 - 70
RPLPKKPKK                                                                  71 - 79
//

Text Mined References (67)

PMID Year Title