Property Summary

NCBI Gene PubMed Count 36
PubMed Score 16.61
PubTator Score 16.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 5.6e-05
spina bifida 1074 4.3e-02
Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 3.582 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.800 5.6e-05
spina bifida -1.288 4.3e-02

Gene RIF (6)

AA Sequence

MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVK      1 - 70
FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANK     71 - 140
RMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKS    141 - 210
QCCSN                                                                     211 - 215
//

Text Mined References (42)

PMID Year Title