Property Summary

NCBI Gene PubMed Count 36
Grant Count 14
R01 Count 9
Funding $792,267.15
PubMed Score 16.81
PubTator Score 16.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.800 0.000
spina bifida -1.288 0.043

Gene RIF (6)

PMID Text
25605758 results suggest that LRRK2 kinase activity functions as a Rab5b GTPase activating protein and thus, negatively regulates Rab5b signalling
24106282 combined genetic association studies in women from China/Netherlands/United States: Data suggest that an SNP in RAB5B locus (rs705702) and SNPs in other proteins are associated with polycystic ovary syndrome across ethnic differences. [META-ANALYSIS]
20526340 Observational study of gene-disease association. (HuGE Navigator)
19723633 suppression of Rab5A or 5B hampered the degradation of EGFR
18445495 Results suggest that LRRK2, in conjunction with its interaction with Rab5b, plays an important role in synaptic function by modulating the endocytosis of synaptic vesicles.
17927960 study shows expression of GTPase-deficient Rab5b in NRK cells results in sequential formation of 3 distinct types of endosomes; study suggests regulatory role for Rab5 in early & late endocytic pathway of membrane trafficking in coordination with PI(3)K

AA Sequence

MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVK      1 - 70
FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANK     71 - 140
RMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKS    141 - 210
QCCSN                                                                     211 - 215
//

Text Mined References (42)

PMID Year Title
27314038 2016 G2385R and I2020T Mutations Increase LRRK2 GTPase Activity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25605758 2015 An early endosome regulator, Rab5b, is an LRRK2 kinase substrate.
24106282 2013 Cross-ethnic meta-analysis of genetic variants for polycystic ovary syndrome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22951725 2013 Association analyses identify three susceptibility Loci for vitiligo in the Chinese Han population.
22885925 2012 Genome-wide association study identifies eight new risk loci for polycystic ovary syndrome.
21269460 2011 Initial characterization of the human central proteome.
20937701 2010 Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.
20526340 2010 Common variants in FOXP1 are associated with generalized vitiligo.
More...