Property Summary

NCBI Gene PubMed Count 41
PubMed Score 108.68
PubTator Score 51.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Polycystic Ovary Syndrome 335
Disease Target Count P-value
ovarian cancer 8492 1.09081454435677E-8
osteosarcoma 7933 3.52459017998967E-7
lung adenocarcinoma 2714 1.18452622629095E-5
atypical teratoid / rhabdoid tumor 4369 4.31251517560338E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 5.14500878324133E-4
cystic fibrosis 1670 7.10574785125008E-4
medulloblastoma, large-cell 6234 7.93254387768428E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0013493316359794
acute quadriplegic myopathy 1157 0.00167392950948099
adult high grade glioma 2148 0.00224574813397368
Atopic dermatitis 944 0.00380328871400182
cutaneous lupus erythematosus 1056 0.00609260065860139
Parkinson's disease 364 0.0166042615175181
non primary Sjogren syndrome sicca 840 0.0178872518291883
psoriasis 6685 0.0189877640050365
Multiple myeloma 1328 0.0191044052824108
ependymoma 2514 0.0267887150969079
subependymal giant cell astrocytoma 2287 0.0344613765230802
astrocytic glioma 2241 0.0387833375800953
Breast cancer 3099 0.0411172923653295
spina bifida 1064 0.0430858952482292

Expression

  Differential Expression (21)

Synonym

Accession P61019 B2R5W8 B4DMQ5 P08886
Symbols LHX
RAB2

Gene

PDB

1Z0A  

  Ortholog (12)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (13)

PMID Text
26938441 This study demonstrated that RAB2A mutation showing the highest statistical significance in Autism and Schizophrenia.
26249043 RAB2A variance has effect on the structure and function of the PFC and related cognitive functions.
26159854 The immunohistochemistry-based validation using tissue microarray slides in oral squamous cell carcinoma revealed overexpression of the RAB2A and PRDX1 gene in 80 and 68 % of the tested clinical cases, respectively.
25818297 Pin1/Rab2A/Erk drives BCSC expansion and tumorigenicity, suggesting potential drug targets.
24700772 As a result of the translocations, RAB2A-PLAG1, the constitutively active promoter of the partner gene drives the ectopic expression of PLAG1.
24251537 first X-ray crystal structure of RicA to 2.7 A resolution and have quantified the affinity of RicA binding to human Rab2 in its GDP-bound and nucleotide-free forms
21501366 The authors identified a specific interaction between the human small GTPase Rab2 and a Brucella spp. protein named RicA.
20308991 The results of this study provided that RAB2A and SLC38A1, were associated with the density of calbindin-positive neurons and the number of perineuronal oligodendrocytes in psychiatric disorders.
20308991 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of RAB2A, member RAS oncogene family (RAB2A) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
More...

AA Sequence

MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRS      1 - 70
ITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFARE     71 - 140
HGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHAATNATHAGNQGGQQAGGG    141 - 210
CC                                                                        211 - 212
//

Text Mined References (46)

PMID Year Title
26938441 2016 De Novo Synonymous Mutations in Regulatory Elements Contribute to the Genetic Etiology of Autism and Schizophrenia.
26249043 2015 RAB2A Polymorphism impacts prefrontal morphology, functional connectivity, and working memory.
26159854 2015 Identification of RAB2A and PRDX1 as the potential biomarkers for oral squamous cell carcinoma using mass spectrometry-based comparative proteomic approach.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25818297 2015 The Rab2A GTPase promotes breast cancer stem cells and tumorigenesis via Erk signaling activation.
25416956 2014 A proteome-scale map of the human interactome network.
24700772 2014 Identification of COL3A1 and RAB2A as novel translocation partner genes of PLAG1 in lipoblastoma.
24251537 2013 Molecular structure of the Brucella abortus metalloprotein RicA, a Rab2-binding virulence effector.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...