Property Summary

NCBI Gene PubMed Count 44
PubMed Score 113.57
PubTator Score 51.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.002 1.7e-03
adult high grade glioma -1.200 2.2e-03
astrocytic glioma -1.600 3.9e-02
Atopic dermatitis -1.100 3.8e-03
atypical teratoid / rhabdoid tumor -1.100 4.3e-04
Breast cancer 3.200 4.1e-02
cutaneous lupus erythematosus -1.600 6.1e-03
cystic fibrosis -1.500 7.1e-04
ependymoma -1.900 2.7e-02
intraductal papillary-mucinous adenoma (... 1.300 5.1e-04
intraductal papillary-mucinous carcinoma... 1.200 1.3e-03
lung adenocarcinoma 1.121 2.8e-04
medulloblastoma, large-cell -1.400 7.9e-04
Multiple myeloma 1.209 1.9e-02
non primary Sjogren syndrome sicca 1.400 1.8e-02
osteosarcoma -1.025 4.4e-02
ovarian cancer -1.200 3.8e-03
Parkinson's disease -1.200 2.8e-02
psoriasis -1.300 1.9e-02
spina bifida -1.128 4.3e-02
subependymal giant cell astrocytoma -1.014 3.4e-02

Gene RIF (16)

AA Sequence

MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRS      1 - 70
ITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFARE     71 - 140
HGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHAATNATHAGNQGGQQAGGG    141 - 210
CC                                                                        211 - 212
//

Text Mined References (49)

PMID Year Title