Property Summary

NCBI Gene PubMed Count 41
Grant Count 53
R01 Count 28
Funding $4,266,116.78
PubMed Score 108.68
PubTator Score 51.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Gene RIF (13)

PMID Text
26938441 This study demonstrated that RAB2A mutation showing the highest statistical significance in Autism and Schizophrenia.
26249043 RAB2A variance has effect on the structure and function of the PFC and related cognitive functions.
26159854 The immunohistochemistry-based validation using tissue microarray slides in oral squamous cell carcinoma revealed overexpression of the RAB2A and PRDX1 gene in 80 and 68 % of the tested clinical cases, respectively.
25818297 Pin1/Rab2A/Erk drives BCSC expansion and tumorigenicity, suggesting potential drug targets.
24700772 As a result of the translocations, RAB2A-PLAG1, the constitutively active promoter of the partner gene drives the ectopic expression of PLAG1.
24251537 first X-ray crystal structure of RicA to 2.7 A resolution and have quantified the affinity of RicA binding to human Rab2 in its GDP-bound and nucleotide-free forms
21501366 The authors identified a specific interaction between the human small GTPase Rab2 and a Brucella spp. protein named RicA.
20308991 The results of this study provided that RAB2A and SLC38A1, were associated with the density of calbindin-positive neurons and the number of perineuronal oligodendrocytes in psychiatric disorders.
20308991 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of RAB2A, member RAS oncogene family (RAB2A) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
More...

AA Sequence

MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRS      1 - 70
ITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKKEEGEAFARE     71 - 140
HGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGPQHAATNATHAGNQGGQQAGGG    141 - 210
CC                                                                        211 - 212
//

Text Mined References (46)

PMID Year Title
26938441 2016 De Novo Synonymous Mutations in Regulatory Elements Contribute to the Genetic Etiology of Autism and Schizophrenia.
26249043 2015 RAB2A Polymorphism impacts prefrontal morphology, functional connectivity, and working memory.
26159854 2015 Identification of RAB2A and PRDX1 as the potential biomarkers for oral squamous cell carcinoma using mass spectrometry-based comparative proteomic approach.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25818297 2015 The Rab2A GTPase promotes breast cancer stem cells and tumorigenesis via Erk signaling activation.
25416956 2014 A proteome-scale map of the human interactome network.
24700772 2014 Identification of COL3A1 and RAB2A as novel translocation partner genes of PLAG1 in lipoblastoma.
24251537 2013 Molecular structure of the Brucella abortus metalloprotein RicA, a Rab2-binding virulence effector.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...