Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.48
PubTator Score 5.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (4)

AA Sequence

MAETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERF      1 - 70
RSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDLDPEREVTFLEASRFA     71 - 140
QENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDPERMGSGIQYGDASLRQLRQPRSAQAVAPQP    141 - 210
CGC                                                                       211 - 213
//

Text Mined References (15)

PMID Year Title