Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.30
PubTator Score 5.15

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P61018 P22750 Q7Z514 Q9HBR6
Symbols

Gene

PDB

2O52  

Gene RIF (3)

PMID Text
24006255 Interaction between Rab4b and AP1gamma allows the budding of clathrin-coated vesicles for subsequent traffic to recycling endosomes.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19590752 Data conclude that Rab4b is a new important player in the control of GLUT4 trafficking in adipocyte.

AA Sequence

MAETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERF      1 - 70
RSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDLDPEREVTFLEASRFA     71 - 140
QENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDPERMGSGIQYGDASLRQLRQPRSAQAVAPQP    141 - 210
CGC                                                                       211 - 213
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24006255 2013 Rab4b controls an early endosome sorting event by interacting with the ?-subunit of the clathrin adaptor complex 1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22081228 2011 Genome-wide association study identifies FCGR2A as a susceptibility locus for Kawasaki disease.
22080838 2012 A genome-wide association study of COPD identifies a susceptibility locus on chromosome 19q13.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19590752 2009 Rab4b is a small GTPase involved in the control of the glucose transporter GLUT4 localization in adipocyte.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...