Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.04
PubTator Score 13.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.389 3.1e-02
Breast cancer 2.200 2.8e-02
cutaneous lupus erythematosus 1.900 3.2e-03
ductal carcinoma in situ 1.300 5.2e-04
interstitial cystitis 1.400 1.2e-02
invasive ductal carcinoma 1.137 1.3e-02
Multiple myeloma 1.341 6.0e-03
non primary Sjogren syndrome sicca 1.100 4.3e-02
osteosarcoma -1.472 7.8e-06
ovarian cancer -1.600 7.4e-07
pancreatic ductal adenocarcinoma liver m... -2.266 1.1e-03
pituitary cancer -1.300 1.9e-04
psoriasis 1.100 1.4e-24
ulcerative colitis 1.200 1.6e-05

 GO Function (1)

Gene RIF (2)

AA Sequence

MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVSRIMLKNVEDFTGPRERSDLGFITFDI      1 - 70
TADLENIFDWNVKQLFLYLSAEYSTKNNALNQVVLWDKIVLRGDNPKLLLKDMKTKYFFFDDGNGLKGNR     71 - 140
NVTLTLSWNVVPNAGILPLVTGSGHVSVPFPDTYEITKSY                                  141 - 180
//

Text Mined References (16)

PMID Year Title