Property Summary

NCBI Gene PubMed Count 11
Grant Count 7
R01 Count 7
Funding $456,897.6
PubMed Score 3.96
PubTator Score 13.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.341 0.006
cutaneous lupus erythematosus 1.900 0.003
osteosarcoma -1.472 0.000
pancreatic ductal adenocarcinoma liver m... -2.266 0.001
active Crohn's disease 1.389 0.031
Breast cancer 2.200 0.028
interstitial cystitis 2.300 0.000
non primary Sjogren syndrome sicca 1.100 0.043
psoriasis 1.100 0.000
invasive ductal carcinoma 1.500 0.001
ductal carcinoma in situ 1.300 0.001
ulcerative colitis 1.400 0.000
ovarian cancer 3.100 0.000
pituitary cancer -1.800 0.000

Synonym

Accession P61009 P12280 Q9H0S7
Symbols SPC3
PRO3567
YLR066W
SPC22/23

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
22190034 HIV-1 gp41 is identified to have a physical interaction with signal peptidase complex subunit 3 homolog (SPCS3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
18187620 Knockdown of signal peptidase complex subunit 3 homolog (SPCS3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVSRIMLKNVEDFTGPRERSDLGFITFDI      1 - 70
TADLENIFDWNVKQLFLYLSAEYSTKNNALNQVVLWDKIVLRGDNPKLLLKDMKTKYFFFDDGNGLKGNR     71 - 140
NVTLTLSWNVVPNAGILPLVTGSGHVSVPFPDTYEITKSY                                  141 - 180
//

Text Mined References (16)

PMID Year Title
27499293 2016 Inverting the Topology of a Transmembrane Protein by Regulating the Translocation of the First Transmembrane Helix.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24480542 2014 Defective minor spliceosome mRNA processing results in isolated familial growth hormone deficiency.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...