Property Summary

NCBI Gene PubMed Count 95
PubMed Score 157.88
PubTator Score 79.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arthritis, Rheumatoid 174 0.0 0.0
Disease Target Count
Rheumatoid arthritis 1191
Disease Target Count P-value
ovarian cancer 8520 5.3e-05
psoriasis 6694 5.8e-04
Multiple myeloma 1332 9.8e-04
astrocytoma 1146 8.5e-03
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.200 8.5e-03
Multiple myeloma 1.154 9.8e-04
ovarian cancer 2.300 5.3e-05
psoriasis -1.200 5.8e-04

Gene RIF (49)

AA Sequence

MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERF      1 - 70
RTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLA     71 - 140
LDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL       141 - 207
//

Text Mined References (108)

PMID Year Title