Property Summary

NCBI Gene PubMed Count 86
Grant Count 83
R01 Count 52
Funding $7,002,982.85
PubMed Score 145.15
PubTator Score 79.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.154 0.001
psoriasis -1.200 0.001
astrocytoma 1.200 0.009
ovarian cancer 2.300 0.000

Synonym

Accession P61006 B4DEK7 P24407 Q6FHV5
Symbols MEL
RAB8

Gene

PDB

4LHX   4LHY   4LHZ   3QBT   3TNF   4LHV   4LHW   4LI0   5SZI  

Gene RIF (46)

PMID Text
26833786 Data demonstrate that EHBP1L1 links Rab8 and the Bin1-dynamin complex, which generates membrane curvature and excises the vesicle at the endocytic recycling compartment for apical transport.
26485645 Further exploration of the NINL-associated interactome identifies MICAL3, a protein known to interact with Rab8 and to play an important role in vesicle docking and fusion.
26471730 Rab8A GTPase Ser(111) phosphorylation is not directly regulated by PINK1 in vitro and demonstrate in cells the time course of Ser(111) phosphorylation of Rab8A, 8B and 13 is markedly delayed compared to phosphorylation of Parkin at Ser(65).
26220176 Intercellular transfer of transferrin receptor by a contact-, Rab8-dependent mechanism involving tunneling nanotubes.
26034069 The small GTPase Rab8 interacts with VAMP-3 to regulate the delivery of recycling T-cell receptors to the immune synapse.
25787272 the role of Rabin8 (a mammalian ortholog of Sec2p) with Rab8-nucleotide-exchange factor activity in autophagy in mammalian cells, was examined.
25673874 DLC3 is recruited to Rab8-positive membrane tubules and is required for the integrity of the Rab8 and Golgi compartments.
25477298 High expression of RAB8A is associated with endometrial cancer.
24983211 Study established a direct interaction between alpha-synclein and Rab8a and provided unique insights into the molecular mechanisms of alpha-synclein toxicity
24892806 Microvilli establishment required interaction between RAB8A and MYO5B, while loss of the interaction between RAB11A and MYO5B induced microvillus inclusions.
More...

AA Sequence

MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERF      1 - 70
RTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLA     71 - 140
LDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL       141 - 207
//

Text Mined References (98)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26833786 2016 EHBP1L1 coordinates Rab8 and Bin1 to regulate apical-directed transport in polarized epithelial cells.
26824392 2016 Phosphoproteomics reveals that Parkinson's disease kinase LRRK2 regulates a subset of Rab GTPases.
26485645 2015 The Ciliopathy Protein CC2D2A Associates with NINL and Functions in RAB8-MICAL3-Regulated Vesicle Trafficking.
26471730 2015 Phosphoproteomic screening identifies Rab GTPases as novel downstream targets of PINK1.
26220176 2015 Intercellular transfer of transferrin receptor by a contact-, Rab8-dependent mechanism involving tunneling nanotubes.
26034069 2015 The small GTPase Rab8 interacts with VAMP-3 to regulate the delivery of recycling T-cell receptors to the immune synapse.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25787272 2015 Rabin8 suppresses autophagosome formation independently of its guanine nucleotide-exchange activity towards Rab8.
25673874 2015 The Rho-specific GAP protein DLC3 coordinates endocytic membrane trafficking.
More...