Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.90
PubTator Score 4.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer 2.153 0.000
cystic fibrosis 2.500 0.006

Gene RIF (1)

PMID Text
15140226 Kdap may serve as a soluble regulator of keratinocyte differentiation.

AA Sequence

MKIPVLPAVVLLSLLVLHSAQGATLGGPEEESTIENYASRPEAFNTPFLNIDKLRSAFKADEFLNWHALF      1 - 70
ESIKRKLPFLNWDAFPKLKGLRSATPDAQ                                              71 - 99
//

Text Mined References (9)

PMID Year Title
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15140226 2004 Characterization of Kdap, a protein secreted by keratinocytes.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11054531 2000 Kdap, a novel gene associated with the stratification of the epithelium.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.