Property Summary

NCBI Gene PubMed Count 15
PubMed Score 181.11
PubTator Score 60.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy 1.158 6.7e-07
aldosterone-producing adenoma -1.140 2.4e-02
Astrocytoma, Pilocytic 1.200 7.9e-04
Atopic dermatitis 1.100 2.3e-04
atypical teratoid / rhabdoid tumor 1.700 1.1e-06
breast carcinoma 1.200 8.5e-19
cutaneous lupus erythematosus 1.200 6.8e-03
diabetes mellitus -1.100 7.8e-03
Down syndrome 1.500 1.0e-03
ductal carcinoma in situ 1.200 6.9e-04
glioblastoma 1.800 1.5e-06
group 4 medulloblastoma 1.100 3.0e-02
intraductal papillary-mucinous neoplasm ... 1.500 4.2e-02
invasive ductal carcinoma 1.900 2.0e-04
lung cancer 1.400 1.0e-02
medulloblastoma, large-cell 1.700 1.1e-03
osteosarcoma 2.415 5.6e-04
ovarian cancer -2.200 1.9e-08
pediatric high grade glioma 1.200 2.4e-03
primitive neuroectodermal tumor 1.100 1.1e-04
progressive supranuclear palsy -1.100 3.2e-02
psoriasis 2.700 1.5e-04
tuberculosis -1.200 2.3e-05

Gene RIF (5)

AA Sequence

MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIV      1 - 70
YSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGF     71 - 140
FH                                                                        141 - 142
//

Text Mined References (22)

PMID Year Title