Property Summary

NCBI Gene PubMed Count 15
Grant Count 22
R01 Count 22
Funding $3,000,663
PubMed Score 169.65
PubTator Score 60.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
22035352 The distribution of GMF-immunoreactive cells in and around amyloid plaques and neurofibrillary tangles suggests involvement of GMF in inflammatory responses through reactive glia and a role of GMF in Alzheimer disease pathology.
21835226 GMF co-localizes with amyloid plaques and neurofibrillary tangles in Alzheimer brains, implicating significant upregulation of GMF expression under conditions of neurodegeneration.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18171522 There is a significant increase in GMF beta protein expression levels in IFN beta-1a treated LX-2 cells.
16115230 GMFB promoted T-cell differentiation into CD4-/CD8+ cells when analysed by two-colour flow cytometry.

AA Sequence

MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIV      1 - 70
YSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGF     71 - 140
FH                                                                        141 - 142
//

Text Mined References (22)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22035352 2012 Expression of glia maturation factor in neuropathological lesions of Alzheimer's disease.
21835226 2011 Augmented expression of glia maturation factor in Alzheimer's disease.
21269460 2011 Initial characterization of the human central proteome.
20547056 2010 Identification of glia maturation factor beta as an independent prognostic predictor for serous ovarian cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
More...