Property Summary

NCBI Gene PubMed Count 15
PubMed Score 169.65
PubTator Score 60.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 8.47474183450579E-19
ovarian cancer 8492 1.91460313380243E-8
acute quadriplegic myopathy 1157 6.70024239369023E-7
atypical teratoid / rhabdoid tumor 4369 1.12382196233631E-6
glioblastoma 5572 1.49025623145957E-6
medulloblastoma 1524 1.1690579635023E-5
tuberculosis and treatment for 3 months 327 1.87943365441724E-5
primitive neuroectodermal tumor 3031 1.08443746692551E-4
psoriasis 6685 1.52025394064038E-4
invasive ductal carcinoma 2950 2.04594122054824E-4
Atopic dermatitis 944 2.26360953788406E-4
osteosarcoma 7933 5.57965320292022E-4
ductal carcinoma in situ 1745 6.88033225291614E-4
pilocytic astrocytoma 3086 7.39473677341859E-4
Down syndrome 548 0.00103283763871954
medulloblastoma, large-cell 6234 0.00113074314542644
pediatric high grade glioma 2712 0.00243846859143187
cutaneous lupus erythematosus 1056 0.00681162872636957
diabetes mellitus 1663 0.00775706811894154
lung cancer 4473 0.0100359698207982
aldosterone-producing adenoma 664 0.0235533579046129
progressive supranuclear palsy 674 0.0324245539203858
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0419608992508493
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 3.747 1.9

Expression

Synonym

Accession P60983 B2R499 P17774 Q9BS35 GMF-beta
Symbols GMF

Gene

PANTHER Protein Class (2)

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
22035352 The distribution of GMF-immunoreactive cells in and around amyloid plaques and neurofibrillary tangles suggests involvement of GMF in inflammatory responses through reactive glia and a role of GMF in Alzheimer disease pathology.
21835226 GMF co-localizes with amyloid plaques and neurofibrillary tangles in Alzheimer brains, implicating significant upregulation of GMF expression under conditions of neurodegeneration.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18171522 There is a significant increase in GMF beta protein expression levels in IFN beta-1a treated LX-2 cells.
16115230 GMFB promoted T-cell differentiation into CD4-/CD8+ cells when analysed by two-colour flow cytometry.

AA Sequence

MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIV      1 - 70
YSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGF     71 - 140
FH                                                                        141 - 142
//

Text Mined References (22)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22035352 2012 Expression of glia maturation factor in neuropathological lesions of Alzheimer's disease.
21835226 2011 Augmented expression of glia maturation factor in Alzheimer's disease.
21269460 2011 Initial characterization of the human central proteome.
20547056 2010 Identification of glia maturation factor beta as an independent prognostic predictor for serous ovarian cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
More...