Property Summary

NCBI Gene PubMed Count 28
PubMed Score 135.98
PubTator Score 201.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.600 1.2e-04
atypical teratoid / rhabdoid tumor -2.100 2.6e-09
autosomal dominant Emery-Dreifuss muscul... 1.066 3.0e-03
Breast cancer -1.200 2.5e-14
colon cancer -1.400 1.4e-04
cystic fibrosis -1.128 2.1e-03
Duchenne muscular dystrophy 1.100 2.9e-07
ependymoma -1.200 2.6e-05
glioblastoma -1.300 3.7e-06
group 4 medulloblastoma -1.300 8.1e-04
lung adenocarcinoma -1.500 7.9e-17
medulloblastoma, large-cell -1.900 2.6e-06
Multiple myeloma 1.145 2.2e-02
osteosarcoma 3.336 3.1e-06
ovarian cancer -1.200 8.3e-06
Pilocytic astrocytoma -1.100 4.0e-04
primitive neuroectodermal tumor -1.200 9.9e-03
spina bifida -1.188 4.6e-02
subependymal giant cell astrocytoma -1.280 4.5e-02

Gene RIF (11)

AA Sequence

MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKH      1 - 70
FVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGP     71 - 140
EDLNRACIAEKLGGSLIVAFEGCPV                                                 141 - 165
//

Text Mined References (41)

PMID Year Title