Property Summary

NCBI Gene PubMed Count 28
Grant Count 109
R01 Count 76
Funding $16,262,924.87
PubMed Score 129.08
PubTator Score 201.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Multiple myeloma 1.426 0.001
osteosarcoma 3.336 0.000
ependymoma -1.200 0.000
glioblastoma -2.000 0.000
cystic fibrosis -1.187 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma -1.500 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.200 0.010
Duchenne muscular dystrophy 1.156 0.000
autosomal dominant Emery-Dreifuss muscul... 1.066 0.003
colon cancer -1.800 0.000
adult high grade glioma -1.600 0.000
pilocytic astrocytoma -1.100 0.000
subependymal giant cell astrocytoma -1.280 0.045
lung adenocarcinoma -1.500 0.000
spina bifida -1.188 0.046
Breast cancer -1.200 0.000
ovarian cancer 3.500 0.000

Synonym

Accession P60981 B2R6N2 B4DYA6 P18282 Q5W166 Q6IAW2
Symbols ADF
ACTDP
HEL32
bA462D18.2

Gene

Gene RIF (11)

PMID Text
26996939 analysis of human Cof1, Cof2, and ADF effects on actin filament severing and turnover
22898637 Destrin is upregulated in nerve-invasive pancreatic cancer cells and its expression might be related to perineural invasiveness
21571222 The ADF/cofilin1-dependent severing of actin filaments exposes and promotes the activation of SPCA1, which pumps Ca(2+) into the lumen of the TGN for the sorting of the class of secretory cargo that binds Ca(2+).
20873970 Changes in the expression of cytoskeletal regulatory proteins such as LIMK and cofilin may play a role in weakening thoracic aortic medial tissue, as a precondition to thoracic aortic dissection.
20835250 The results of this study suggested that temporally regulated ADF/cofilin activities function in postsynaptic modifications of receptor number and spine size during synaptic plasticity.
17583572 destrin is a significant regulator of various processes important for invasive phenotype of human colon cancer Isreco1 cells whereas cofilin-1 may be involved in only a subset of them
17196218 In the absence of any crystal structures of ADF or cofilin in complex with actin, these studies provide further information about the binding sites on F-actin for these important actin regulatory proteins.
15816841 downregulated following UV exposure in epidermis
14627701 Important sequence differences between actin-depolymerizing factor/cofilin were correlated with unique structural determinants in the F-actin-binding site to account for differences in biochemical activities of the two proteins.
12775419 Genes, including GABRP, ADF, HINT, PRSS2, SDCBP, PTK9, PPP2R5B, ITGA3, PRKCBP1, HMOX2, HAT1, PPP1cB, and ICAM-1, are upregulated after treatment of human astrocytes with HIV-1 gp120
More...

AA Sequence

MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKH      1 - 70
FVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGP     71 - 140
EDLNRACIAEKLGGSLIVAFEGCPV                                                 141 - 165
//

Text Mined References (41)

PMID Year Title
26996939 2016 TIRF microscopy analysis of human Cof1, Cof2, and ADF effects on actin filament severing and turnover.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23509613 2013 Genome-wide association study of antiphospholipid antibodies.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22898637 The actin binding protein destrin is associated with growth and perineural invasion of pancreatic cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21571222 2011 ADF/cofilin regulates secretory cargo sorting at the TGN via the Ca2+ ATPase SPCA1.
More...