Property Summary

Ligand Count 1
NCBI Gene PubMed Count 492
PubMed Score 2188.49
PubTator Score 1245.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -3.100 2.8e-08
astrocytic glioma -3.300 1.2e-03
Astrocytoma, Pilocytic -3.700 1.4e-15
atypical teratoid / rhabdoid tumor -3.200 3.5e-06
ependymoma -4.200 7.5e-04
gastric cancer -1.200 6.5e-04
glioblastoma -3.100 3.7e-12
group 3 medulloblastoma -1.700 1.4e-02
hepatocellular carcinoma -1.200 7.8e-05
lung cancer -2.300 1.2e-03
medulloblastoma, large-cell -2.200 2.1e-04
Multiple myeloma 1.200 1.6e-03
oligodendroglioma -3.300 3.8e-03
ovarian cancer -1.400 1.2e-06
Pick disease -2.200 1.2e-03
subependymal giant cell astrocytoma -2.967 1.0e-02

Gene RIF (327)

AA Sequence

MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPL      1 - 70
SYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPE     71 - 140
TAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL                       141 - 191
//

Text Mined References (505)

PMID Year Title