Property Summary

NCBI Gene PubMed Count 90
Grant Count 108
R01 Count 69
Funding $14,050,507.27
PubMed Score 180.61
PubTator Score 935.19

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P60903 A8K4V8 P08206 Q5T1C5
Symbols 42C
P11
p10
GP11
ANX2L
CAL1L
CLP11
Ca[1]
ANX2LG

Gene

PDB

4DRW   4FTG   4HRG   1A4P   1BT6   4HRE   4HRH  

Gene RIF (59)

PMID Text
26925708 annexin A2 and S100A10 expressions are powerful predictors of serous ovarian cancer outcome.
26465153 These data show that disruption of ANX2/p11 interaction results in reduced ALL cell adhesion to osteoblasts, increased ALL cell sensitization to chemotherapy, and suppression of ALL cell homing and engraftment.
25428414 TPH1 gene polymorphisms and S100A10 expression, which correlate with 5-HT signaling were associated with ramosetron effectiveness in IBS-D, and may possibly lead to prospective identification of the resistance to treatment.
25303710 Annexin A2 complexes with S100 proteins: structure, function and pharmacological manipulation
23994525 an annexin A2-S100A10 molecular bridge participates in cell-cell interactions, revealing a hitherto unexplored function of this protein interaction
23931152 Authors show here that AnxA2, p11 and AHNAK are required for type 3 secretion system-mediated Salmonella invasion of cultured epithelial cells.
23828264 Data suggest a role for S100A10 as a prognostic marker and potential therapeutic target in colorectal cancer.
23757730 complex formation of AnxA2 with S100A10 is a central regulatory mechanism in the acute release of VWF in response to cAMP-elevating agonists
23696646 extracellular C-1-P, acting through the extracellular annexin a2-p11 heterotetrameric protein, can mediate vascular endothelial cell invasion.
23637395 Annexin A2 and S100A10 regulate human papillomavirus type 16 entry and intracellular trafficking in human keratinocytes.
More...

AA Sequence

MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQ      1 - 70
SFFSLIAGLTIACNDYFVVHMKQKGKK                                                71 - 97
//

Text Mined References (95)

PMID Year Title
26925708 2016 Annexin A2 and S100A10 are independent predictors of serous ovarian cancer outcome.
26465153 2015 Disruption of Annexin II /p11 Interaction Suppresses Leukemia Cell Binding, Homing and Engraftment, and Sensitizes the Leukemia Cells to Chemotherapy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25428414 2015 Pilot study of Biomarkers for predicting effectiveness of ramosetron in diarrhea-predominant irritable bowel syndrome: expression of S100A10 and polymorphisms of TPH1.
25303710 2015 Annexin A2 complexes with S100 proteins: structure, function and pharmacological manipulation.
24457100 2014 Angiogenin interacts with the plasminogen activation system at the cell surface of breast cancer cells to regulate plasmin formation and cell migration.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23994525 2013 Protein interactions between surface annexin A2 and S100A10 mediate adhesion of breast cancer cells to microvascular endothelial cells.
23931152 2014 The Annexin A2/p11 complex is required for efficient invasion of Salmonella Typhimurium in epithelial cells.
23861394 2013 Lipid segregation and membrane budding induced by the peripheral membrane binding protein annexin A2.
More...