Property Summary

NCBI Gene PubMed Count 90
PubMed Score 614.41
PubTator Score 40.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Myocardial Infarction 151 0.0 0.0
Disease Target Count Z-score Confidence
psoriasis 6694 0.0 3.0

Expression

Gene RIF (63)

AA Sequence

MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLF      1 - 70
KITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIL     71 - 140
IGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDF    141 - 210
KPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD                                      211 - 246
//

Text Mined References (106)

PMID Year Title