Property Summary

NCBI Gene PubMed Count 40
Grant Count 43
R01 Count 34
Funding $4,537,562.3
PubMed Score 627.13
PubTator Score 170.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
non-small cell lung cancer 1.009 0.000
lung cancer 1.500 0.000
sonic hedgehog group medulloblastoma 1.100 0.000
Pneumonia -1.800 0.002
subependymal giant cell astrocytoma 1.080 0.015

Gene RIF (19)

PMID Text
26839112 three phenotypic subregions within the SHFM1 locus link both size and genomic position of the chromosomal aberrations to the clinical variability seen in SHFM1 patients
26145171 by targeting RPA and mimicking DNA, DSS1 functions with BRCA2 in a two-component homologous recombination mediator complex in genome maintenance and tumor suppression
25697906 SHFM1 confers cell cycle progression and resistance to p53 stabilizing drugs in gastric cancer cells.
24289229 Breast cancers with high DSS1 expression have worse prognosis and shorter relapse-free survival times.
23371468 Mutation screening of the SHFM1 gene in familial breast/ovarian cancer cases.
23024267 DSS1 protein is critically involved in the maintenance of the transformed phenotype in cervical cancer cells, and that it might be a specific, robust and reliable marker for early detection, diagnosis and trea
20817001 DSS1 has a role in homologous recombinational repair in human cells
20808887 p63 binds to an enhancer element in the SHFM1 locus and this element controls expression of DLX6 and DLX5 which are important for limb development.
20610542 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20220765 The DSS1 c.143G>A variant is associated with reduced DSS1 expression at RNA and protein levels and altered traffic of the DSS1 protein from the cytoplasm to the nucleus. These alterations could impair DSS1 function and may be implicated in skin cancer.
More...

AA Sequence

MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS      1 - 70
//

Text Mined References (43)

PMID Year Title
26839112 2016 Phenotypic subregions within the split-hand/foot malformation 1 locus.
26145171 2015 Promotion of BRCA2-Dependent Homologous Recombination by DSS1 via RPA Targeting and DNA Mimicry.
25697906 2015 Upregulated, 7q21-22 amplicon candidate gene SHFM1 confers oncogenic advantage by suppressing p53 function in gastric cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25293881 2015 The contribution of common genetic variation to nicotine and cotinine glucuronidation in multiple ethnic/racial populations.
24896180 2014 BRCA2 prevents R-loop accumulation and associates with TREX-2 mRNA export factor PCID2.
24289229 2013 Breast cancers with high DSS1 expression that potentially maintains BRCA2 stability have poor prognosis in the relapse-free survival.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23371468 2013 Mutation analysis of the SHFM1 gene in breast/ovarian cancer families.
23024267 2013 Identification of the deleted in split hand/split foot 1 protein as a novel biomarker for human cervical cancer.
More...