Property Summary

NCBI Gene PubMed Count 17
Grant Count 3
Funding $560,358.5
PubMed Score 20.90
PubTator Score 9.03

Knowledge Summary

Patent (4,530)

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
ependymoma -1.800 0.034
glioblastoma -2.300 0.000
cystic fibrosis 1.024 0.000
medulloblastoma, large-cell -2.400 0.002
interstitial cystitis -1.600 0.002
pediatric high grade glioma -1.600 0.000
sonic hedgehog group medulloblastoma 1.500 0.002
subependymal giant cell astrocytoma -1.766 0.035
pituitary cancer 2.100 0.000

Synonym

Accession P60893 Q9JHI6 Q9NPD1
Symbols SREB
SREB2

Gene

PANTHER Protein Class (2)

  TechDev Info (3)

Bryan Roth functional assay
Jing-Ruey Yeh gRNA validated for zebrafish model, zebrafish mutant available
Steve Finkbeiner Neuron specific phenotypes being screened

Gene RIF (4)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of G protein-coupled receptor 85 (GPR85) in primary human brain microvascular endothelial cells
22968816 Risk-associated variants in GPR85 are associated with phenotypes similar to those found in patients with schizophrenia.
18413613 Theses data implicate SREB2 as a potential risk factor for psychiatric disorders.
15893849 The areas expressing high levels of SREB2 mRNA overlap with brain structures known to possess high levels of plasticity, namely, the hippocampal formation, olfactory system, and supraoptic and paraventricular nuclei.

AA Sequence

MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLLDLCCSDILRS      1 - 70
AICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRYLAIAHHRFYTKRLTFWTCLA     71 - 140
VICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFRANDSLGFMLLLALILLATQLVYLKLIFFVH    141 - 210
DRRKMKPVQFVAAVSQNWTFHGPGASGQAAANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKME    211 - 280
KRISRMFYIMTFLFLTLWGPYLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCF    281 - 350
STTLLYCRKSRLPREPYCVI                                                      351 - 370
//

Text Mined References (18)

PMID Year Title
25780553 2015 The association of GPR85 with PSD-95-neuroligin complex and autism spectrum disorder: a molecular analysis.
22968816 2013 Effect of schizophrenia risk-associated alleles in SREB2 (GPR85) on functional MRI phenotypes in healthy volunteers.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
18413613 2008 The evolutionarily conserved G protein-coupled receptor SREB2/GPR85 influences brain size, behavior, and vulnerability to schizophrenia.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15893849 2005 A conserved mRNA expression profile of SREB2 (GPR85) in adult human, monkey, and rat forebrain.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
12853948 2003 The DNA sequence of human chromosome 7.
More...