Property Summary

NCBI Gene PubMed Count 184
PubMed Score 385.00
PubTator Score 621.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Congenital myasthenic syndrome 25 0.0 4.0
Intellectual disability 1016 0.0 4.0
Disease Target Count
congenital myasthenic syndrome 18 1

Expression

  Differential Expression (22)

Disease log2 FC p
Alzheimer's disease -2.000 4.9e-02
adrenocortical carcinoma 1.251 2.4e-02
adult high grade glioma -3.400 4.9e-04
astrocytic glioma -2.600 6.2e-03
Astrocytoma, Pilocytic -2.800 1.2e-05
atypical teratoid / rhabdoid tumor -4.800 3.3e-15
colon cancer -1.300 2.0e-03
cystic fibrosis 2.501 1.6e-05
ependymoma -4.000 8.6e-03
glioblastoma -3.100 3.2e-08
group 3 medulloblastoma -1.500 2.8e-03
interstitial cystitis 1.100 3.0e-02
lung carcinoma 5.200 3.5e-51
malignant mesothelioma -1.800 5.4e-07
medulloblastoma, large-cell -2.500 2.3e-07
nasopharyngeal carcinoma 1.400 1.8e-02
oligodendroglioma -2.600 3.2e-14
osteosarcoma 2.013 1.4e-08
Parkinson's disease -1.800 2.0e-02
Pick disease -3.400 1.2e-03
primitive neuroectodermal tumor -2.900 5.4e-05
subependymal giant cell astrocytoma -5.160 9.6e-04

Protein-protein Interaction (3)

Gene RIF (137)

AA Sequence

MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKD      1 - 70
MKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTND     71 - 140
ARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG        141 - 206
//

Text Mined References (186)

PMID Year Title