Property Summary

NCBI Gene PubMed Count 171
Grant Count 372
R01 Count 229
Funding $44,818,663.1
PubMed Score 350.93
PubTator Score 621.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -6.300 0.000
astrocytoma -4.300 0.001
posterior fossa group A ependymoma -5.700 0.000
glioblastoma -5.700 0.000
oligodendroglioma -2.600 0.000
osteosarcoma 2.013 0.000
medulloblastoma -2.300 0.000
cystic fibrosis 2.501 0.000
atypical teratoid / rhabdoid tumor -6.200 0.000
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -2.900 0.000
adrenocortical carcinoma 1.850 0.017
colon cancer -2.100 0.000
Parkinson's disease -1.800 0.020
interstitial cystitis 2.800 0.000
pediatric high grade glioma -4.100 0.000
pilocytic astrocytoma -2.800 0.000
subependymal giant cell astrocytoma -5.160 0.001
nasopharyngeal carcinoma 1.400 0.018
lung carcinoma 5.200 0.000
Alzheimer's disease -2.000 0.049
Pick disease -3.400 0.001

Synonym

Accession P60880 B2RAU4 D3DW16 D3DW17 P13795 P36974 P70557 P70558 Q53EM2 Q5U0B5 Q8IXK3 Q96FM2 Q9BR45 SNAP-25
Symbols SUP
RIC4
SEC9
SNAP
CMS18
RIC-4
SNAP-25
bA416N4.2
dJ1068F16.2

Gene

PDB

3RK2   3RK3   3RL0   2N1T   1KIL   1XTG   3DDA   3DDB   3ZUR  

Gene RIF (125)

PMID Text
26779543 Snap25 rs363050 (G) allele, which results in a reduced expression of Snap25, is associated with altered glycemic parameters in T2DM possibly because of reduced functionality in the exocytotic machinery leading to suboptimal release of insulin.
26395074 single nucleotide polymorphisms in either the region of NEUROD6 or SNAP25 were significantly associated with Alzheimer's Disease, in APOE4+ females and APOE4+ males, respectively.
26241848 BoNT-A injection, but not Lipotoxin instillation, effectively cleaves SNAP-25 in the suburothelium.
26204769 Patterns of the immunoreactivity with antibodies to SNAP-25, synapsin-I and synaptophysin are completely appropriate to those of adult's OB on the 38-40 weeks of the prenatal development.
25766323 Upon glucose stimulation BAG3 is phosphorylated by FAK and dissociates from SNAP-25 allowing the formation of the SNARE complex, destabilization of the F-actin network and insulin release.
25698757 The results show that the positively charged amino acids at the SNAP-25 C terminus promote tight SNARE complex zippering and are required for high release frequency and rapid release in individual fusion events.
25678324 Data demonstrate a role for SNAP-25 in controlling PSD-95 clustering and open the possibility that genetic reductions of the protein levels may contribute to the pathology through an effect on postsynaptic function and plasticity.
25655772 The expression of SNAP-25 within the enteric nervous system and its downregulation in DD suggest an essential role in enteric neurotransmission and as a marker for impaired synaptic plasticity in enteric neuropathies.
25650683 SNPs in SNAP25 represent a common risk factor of both schizophrenia and major depressive disorder in the Han Chinese population.
25629685 The rs363050 gene polymorphism correlates with decreasing cognitive scores in autistic children.
More...

AA Sequence

MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKD      1 - 70
MKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTND     71 - 140
ARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG        141 - 206
//

Text Mined References (171)

PMID Year Title
26779543 2016 Synaptosomal Protein of 25 kDa (Snap25) Polymorphisms Associated with Glycemic Parameters in Type 2 Diabetes Patients.
26395074 2015 Leveraging existing data sets to generate new insights into Alzheimer's disease biology in specific patient subsets.
26241848 2015 Presence of Cleaved Synaptosomal-Associated Protein-25 and Decrease of Purinergic Receptors P2X3 in the Bladder Urothelium Influence Efficacy of Botulinum Toxin Treatment for Overactive Bladder Syndrome.
26204769 [Development of the Human Olfactory Bulbs in the Prenatal Ontogenesis: an Immunochistochemical Study with Markers of Presynaptic Terminals (anti-SNAP-25, -Synapsin-I, -Synaptophysin)].
25766323 2015 BAG3 regulates formation of the SNARE complex and insulin secretion.
25698757 2015 Positively charged amino acids at the SNAP-25 C terminus determine fusion rates, fusion pore properties, and energetics of tight SNARE complex zippering.
25678324 2015 Reduced SNAP-25 increases PSD-95 mobility and impairs spine morphogenesis.
25655772 2015 SNAP-25 is abundantly expressed in enteric neuronal networks and upregulated by the neurotrophic factor GDNF.
25650683 2015 SNAP25 is associated with schizophrenia and major depressive disorder in the Han Chinese population.
25629685 2015 Association between SNAP-25 gene polymorphisms and cognition in autism: functional consequences and potential therapeutic strategies.
More...