Property Summary

NCBI Gene PubMed Count 37
PubMed Score 80.15
PubTator Score 64.12

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.055 7.2e-03
atypical teratoid / rhabdoid tumor -1.400 4.8e-03
Breast cancer -1.100 2.1e-08
cutaneous lupus erythematosus -1.200 4.6e-02
cystic fibrosis -1.300 1.5e-04
glioblastoma -1.100 1.0e-02
lung cancer 1.100 6.0e-04
malignant mesothelioma 1.800 7.1e-06
ovarian cancer -1.100 4.1e-05
psoriasis -1.200 1.4e-04

Gene RIF (7)

AA Sequence

MAFKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPC      1 - 70
GEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA                          71 - 119
//

Text Mined References (46)

PMID Year Title