Property Summary

NCBI Gene PubMed Count 33
Grant Count 48
Funding $13,528,105.41
PubMed Score 74.65
PubTator Score 64.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
cutaneous lupus erythematosus -1.200 0.046
psoriasis -3.500 0.000
atypical teratoid / rhabdoid tumor -1.400 0.005
glioblastoma -1.100 0.010
lung cancer 1.100 0.001
cystic fibrosis -1.300 0.000
aldosterone-producing adenoma -1.055 0.007
Breast cancer -1.100 0.000
ovarian cancer -1.100 0.000

Gene RIF (6)

PMID Text
26506620 increased expression of RPS11 and RPS20 predicts shorter patient survival. treatment-resistant GSC clones are clinically relevant cells that represent resistant tumorigenic clones from patient tumors and that their properties
24941021 Mutations in RPS20 can predispose individuals to microsatellite-stable hereditary nonpolyposis colorectal carcinoma.
23874713 RPL37, RPS15 and RPS20 regulate the Mdm2-p53-MdmX network but employ different mechanisms to do so.
22534017 HIV-1 Nef immunocomplexes analyzed by mass spectrometry reveal that ribosomal protein S20 (RPS20) is a Nef-binding protein in Jurkat cells
20546612 Observational study of gene-disease association. (HuGE Navigator)
16968546 Gain of 8q-mapped RPS20 is associated with adverse outcome in Medulloblastoma.

AA Sequence

MAFKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPC      1 - 70
GEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA                          71 - 119
//

Text Mined References (41)

PMID Year Title
26506620 2015 Ribosomal Proteins RPS11 and RPS20, Two Stress-Response Markers of Glioblastoma Stem Cells, Are Novel Predictors of Poor Prognosis in Glioblastoma Patients.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24941021 2014 Germline mutation of RPS20, encoding a ribosomal protein, causes predisposition to hereditary nonpolyposis colorectal carcinoma without DNA mismatch repair deficiency.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23874713 2013 Ribosomal proteins RPL37, RPS15 and RPS20 regulate the Mdm2-p53-MdmX network.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...