Property Summary

NCBI Gene PubMed Count 17
PubMed Score 48.83
PubTator Score 38.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
OOCYTE MATURATION DEFECT 1 1 0.0 0.0
Disease Target Count P-value
psoriasis 6694 2.1e-24
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Oophoritis 10 5.529 2.8
Ovarian dysfunction 18 4.372 2.2
Diphtheria 40 3.509 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.800 2.1e-24

Gene RIF (11)

AA Sequence

MAGGSATTWGYPVALLLLVATLGLGRWLQPDPGLPGLRHSYDCGIKGMQLLVFPRPGQTLRFKVVDEFGN      1 - 70
RFDVNNCSICYHWVTSRPQEPAVFSADYRGCHVLEKDGRFHLRVFMEAVLPNGRVDVAQDATLICPKPDP     71 - 140
SRTLDSQLAPPAMFSVSTPQTLSFLPTSGHTSQGSGHAFPSPLDPGHSSVHPTPALPSPGPGPTLATLAQ    141 - 210
PHWGTLEHWDVNKRDYIGTHLSQEQCQVASGHLPCIVRRTSKEACQQAGCCYDNTREVPCYYGNTATVQC    211 - 280
FRDGYFVLVVSQEMALTHRITLANIHLAYAPTSCSPTQHTEAFVVFYFPLTHCGTTMQVAGDQLIYENWL    281 - 350
VSGIHIQKGPQGSITRDSTFQLHVRCVFNASDFLPIQASIFPPPSPAPMTQPGPLRLELRIAKDETFSSY    351 - 420
YGEDDYPIVRLLREPVHVEVRLLQRTDPNLVLLLHQCWGAPSANPFQQPQWPILSDGCPFKGDSYRTQMV    421 - 490
ALDGATPFQSHYQRFTVATFALLDSGSQRALRGLVYLFCSTSACHTSGLETCSTACSTGTTRQRRSSGHR    491 - 560
NDTARPQDIVSSPGPVGFEDSYGQEPTLGPTDSNGNSSLRPLLWAVLLLPAVALVLGFGVFVGLSQTWAQ    561 - 630
KLWESNRQ                                                                  631 - 638
//

Text Mined References (17)

PMID Year Title