Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
Funding $472,983.24
PubMed Score 48.07
PubTator Score 38.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.800 0.000

Synonym

Accession P60852
Symbols OOMD
OOMD1
HEL163

Gene

ZP1

Gene RIF (11)

PMID Text
24670168 this study identified a homozygous frameshift mutation in ZP1 in six family members with a form of infertility with an autosomal recessive mode of inheritance.
22889493 observed sequence variations in exons of ZP1 gene in women with infertility of unknown origin who exhibit abnormal zona pellucida; sperm-ovum interactions appear relatively normal in these patients [CASE REPORTS]
20831819 The 'ZP domain' module of human ZP1 has functional activity and may have a role during fertilization in humans.
20532885 Observational study of gene-disease association. (HuGE Navigator)
20504872 ZP1 binds to capacitated spermatozoa and induces acrosomal exocytosis.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
18033806 ZP proteins were detected in both the oocyte and the granulosa cells as early as the primordial follicle stage in the human. The detection of ZP proteins in the quiescent primordial follicle suggests that these proteins have been present since oogenesis.
15860499 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAGGSATTWGYPVALLLLVATLGLGRWLQPDPGLPGLRHSYDCGIKGMQLLVFPRPGQTLRFKVVDEFGN      1 - 70
RFDVNNCSICYHWVTSRPQEPAVFSADYRGCHVLEKDGRFHLRVFMEAVLPNGRVDVAQDATLICPKPDP     71 - 140
SRTLDSQLAPPAMFSVSTPQTLSFLPTSGHTSQGSGHAFPSPLDPGHSSVHPTPALPSPGPGPTLATLAQ    141 - 210
PHWGTLEHWDVNKRDYIGTHLSQEQCQVASGHLPCIVRRTSKEACQQAGCCYDNTREVPCYYGNTATVQC    211 - 280
FRDGYFVLVVSQEMALTHRITLANIHLAYAPTSCSPTQHTEAFVVFYFPLTHCGTTMQVAGDQLIYENWL    281 - 350
VSGIHIQKGPQGSITRDSTFQLHVRCVFNASDFLPIQASIFPPPSPAPMTQPGPLRLELRIAKDETFSSY    351 - 420
YGEDDYPIVRLLREPVHVEVRLLQRTDPNLVLLLHQCWGAPSANPFQQPQWPILSDGCPFKGDSYRTQMV    421 - 490
ALDGATPFQSHYQRFTVATFALLDSGSQRALRGLVYLFCSTSACHTSGLETCSTACSTGTTRQRRSSGHR    491 - 560
NDTARPQDIVSSPGPVGFEDSYGQEPTLGPTDSNGNSSLRPLLWAVLLLPAVALVLGFGVFVGLSQTWAQ    561 - 630
KLWESNRQ                                                                  631 - 638
//

Text Mined References (16)

PMID Year Title
24670168 2014 Mutant ZP1 in familial infertility.
22889493 2012 Genetic and physiological study of morphologically abnormal human zona pellucida.
20831819 2010 'ZP domain' of human zona pellucida glycoprotein-1 binds to human spermatozoa and induces acrosomal exocytosis.
20532885 2010 Study of 18 functional hemostatic polymorphisms in mucocutaneous bleeding disorders.
20504872 2010 In humans, zona pellucida glycoprotein-1 binds to spermatozoa and induces acrosomal exocytosis.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
18033806 2008 Detection of zona pellucida proteins during human folliculogenesis.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
More...