Property Summary

NCBI Gene PubMed Count 30
Grant Count 33
R01 Count 31
Funding $1,471,519.49
PubMed Score 1.49
PubTator Score 76.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 0.002
adult high grade glioma -1.500 0.001
group 3 medulloblastoma 1.500 0.039
invasive ductal carcinoma 1.200 0.001

Gene RIF (16)

PMID Text
26469953 RAC3 is an inhibitor of senescence whose downregulation in aged individuals could be probably a tumor suppressor mechanism.
25854406 Efficient silencing of Rac3 strongly inhibited A549 cell proliferation.
24684802 Collectively these data unveil that FBXL19 functions as an antagonist of Rac3 by regulating its stability and regulates the TGFbeta1-induced E-cadherin down-regulation.
23388133 Report role of Rac3 in breast cancer aggressiveness and show the potential usefulness of Rac3 depletion in breast cancer therapy.
22957814 Hypoxia inhibits the RAC3 gene expression leading to the autophagy process, allowing tumor cells to survive until angiogenesis occurs
22918955 Rac1b forms a complex with NADPH oxidase and promotes the production of reactive oxygen species, expression of Snail, and activation of the epithelial-mesenchymal transition program.
22786680 Activation of epithelial-mesenchymal transition by MMP-induced expression of Rac1b gave rise to lung adenocarcinoma.
22370642 RAC3 bound tightly to the ARE enhancer region of the HO-1 promoter via Nrf2 binding.
21852230 Rac3 GTPase has a role in the regulation of autophagy
21217774 RAC3 is a novel ERalpha co-activator that promotes cell migration and has prognostic value for ERalpha-positive breast cancer metastasis.
More...

AA Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPL      1 - 70
SYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYP     71 - 140
QGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF                      141 - 192
//

Text Mined References (33)

PMID Year Title
26469953 2015 RAC3 more than a nuclear receptor coactivator: a key inhibitor of senescence that is downregulated in aging.
25854406 2015 Silencing of Rac3 inhibits proliferation and induces apoptosis of human lung cancer cells.
24684802 2014 F-box protein complex FBXL19 regulates TGF?1-induced E-cadherin down-regulation by mediating Rac3 ubiquitination and degradation.
24141704 2013 A bacterial toxin catalyzing tyrosine glycosylation of Rho and deamidation of Gq and Gi proteins.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23388133 2013 Rac3 induces a molecular pathway triggering breast cancer cell aggressiveness: differences in MDA-MB-231 and MCF-7 breast cancer cell lines.
22957814 2012 Nuclear receptor coactivator RAC3 inhibits autophagy.
22918955 2012 Matrix compliance regulates Rac1b localization, NADPH oxidase assembly, and epithelial-mesenchymal transition.
22786680 2012 Matrix metalloproteinase induction of Rac1b, a key effector of lung cancer progression.
22370642 2013 The nuclear cofactor RAC3/AIB1/SRC-3 enhances Nrf2 signaling by interacting with transactivation domains.
More...