Property Summary

NCBI Gene PubMed Count 268
PubMed Score 2726.99
PubTator Score 164.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
lung adenocarcinoma 2714 9.6769925556411E-10
ovarian cancer 8492 5.73526970767663E-9
ependymoma 2514 1.97788144364891E-4
primitive neuroectodermal tumor 3031 2.62739464270285E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.79316221551945E-4
osteosarcoma 7933 3.35752051600661E-4
primary pancreatic ductal adenocarcinoma 1271 3.73302326484945E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 6.89072451063778E-4
dermatomyositis 967 7.05614895823719E-4
pancreatic cancer 2300 7.17921937650781E-4
medulloblastoma, large-cell 6234 0.00273673478982934
Multiple myeloma 1328 0.00354468574861011
astrocytoma 1493 0.0046654743043845
pilocytic astrocytoma 3086 0.00626930917214833
Rheumatoid Arthritis 1171 0.00922080347163404
Down syndrome 548 0.0109754367655576
atypical teratoid/rhabdoid tumor 1095 0.0114010707524998
pediatric high grade glioma 2712 0.0123897880782687
head and neck cancer and chronic obstructive pulmonary disease 237 0.0131751355404521
glioblastoma 5572 0.0137826147261232
group 4 medulloblastoma 1875 0.0243561867595652
Disease Target Count Z-score Confidence
Baraitser-Winter syndrome 8 4.692 2.3
Disease Target Count Z-score Confidence
Dystonia 77 0.0 4.0
Intellectual disability 573 0.0 4.0
Disease Target Count
Dystonia, juvenile-onset 1

Expression

Synonym

Accession P60709 P02570 P70514 P99021 Q11211 Q64316 Q75MN2 Q96B34 Q96HG5
Symbols BRWS1
PS1TP5BP1

Gene

PDB

3LUE   3D2U   3BYH   3J82  

  Ortholog (15)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly OMA Inparanoid

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652107 other 2 / 0 / 0 Actin Polymerization inhibition by compounds from Cdc42 Probe Extension Project

Gene RIF (116)

PMID Text
26713879 crucial role of Glu270 in ADP-ribosylation of actin by Ia
26362536 HIV-1 Gag interacts with ACTB as demonstrated by proximity dependent biotinylation proteomics
26210823 Studies indicate that the process of megakaryocyte maturation and the formation of proplatelets are essential steps in the production of mature platelets and both depend heavily on the actin and microtubule cytoskeletons.
25690657 Data suggest that by binding to both clathrin and F-actin, mammalian actin-binding protein 1 (mAbp1; HIP-55 or SH3P7) is specifically recruited at a late stage of clathrin-coated pits (CCPs) formation, which subsequently recruits dynamin to CCPs.
25419715 Data show that tripartite motif-containing 28 protein (TRIM28) and beta-actin were up-regulated in the glioblastoma multiforme (GBM) stem-like cells compared to the controls.
25255767 The results indicate that the disease-related human beta-actin mutations p.R183W and p.E364K affect interdomain mobility and nucleotide interactions as a basis for the formation of disease phenotypes in patients.
24962707 Data indicate the WASp-interacting protein (WIP)-Wiskott-Aldrich syndrome protein (WASp) interaction in the regulation of actin-dependent processes.
24826067 Downregulation of the HuR gene results in decreased beta-actin gene expression, which in turn results in decreased motility and proliferation of corneal fibroblasts.
24789789 Taken together, these findings indicate that actin filament dynamics are dispensable for HIV-1 Gag assembly at the plasma membrane of HeLa cells.
24789788 Thus, the nucleocapsid domain in HIV-1 Gag does not appear to have a role in actin recruitment or actin incorporation into HIV-1 particles.
More...

AA Sequence

MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP      1 - 70
IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVL     71 - 140
SLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVR    141 - 210
DIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFN    211 - 280
SIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS    281 - 350
TFQQMWISKQEYDESGPSIVHRKCF                                                 351 - 375
//

Text Mined References (277)

PMID Year Title
26713879 2015 Roles of Asp179 and Glu270 in ADP-Ribosylation of Actin by Clostridium perfringens Iota Toxin.
26465922 2016 Altered ?-synuclein, parkin, and synphilin isoform levels in multiple system atrophy brains.
26228148 2015 ACTIN-DIRECTED TOXIN. ACD toxin-produced actin oligomers poison formin-controlled actin polymerization.
26210823 2015 Cytoskeletal regulation of platelet formation: Coordination of F-actin and microtubules.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25773886 2015 Microchimerism in alopecia areata.
25690657 2015 Mammalian actin-binding protein 1/HIP-55 is essential for the scission of clathrin-coated pits by regulating dynamin-actin interaction.
25419715 2014 TRIM28 and ?-actin identified via nanobody-based reverse proteomics approach as possible human glioblastoma biomarkers.
25416956 2014 A proteome-scale map of the human interactome network.
25255767 2014 Molecular mechanisms of disease-related human ?-actin mutations p.R183W and p.E364K.
More...