Property Summary

NCBI Gene PubMed Count 7
Grant Count 9
R01 Count 9
Funding $802,856.67
PubMed Score 8.44
PubTator Score 4.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cowpox 15 4.377 2.2
Nephrolithiasis 30 3.815 1.9

Gene RIF (1)

PMID Text
19419568 Porfilin 3 has the actin-binding site conserved, but retains only approximately half of the common poly-L-proline binding site.

AA Sequence

MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRHTFLQAGLSVGGRR      1 - 70
CCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGILNKTVHELIRGLRMQGA        71 - 137
//

Text Mined References (8)

PMID Year Title
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22396660 2012 A genome-wide association study of nephrolithiasis in the Japanese population identifies novel susceptible Loci at 5q35.3, 7p14.3, and 13q14.1.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
19419568 2009 Testis-expressed profilins 3 and 4 show distinct functional characteristics and localize in the acroplaxome-manchette complex in spermatids.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11867228 2002 Genomic organization of profilin-III and evidence for a transcript expressed exclusively in testis.