Property Summary

NCBI Gene PubMed Count 25
Grant Count 6
R01 Count 5
Funding $1,467,625
PubMed Score 73.65
PubTator Score 21.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.700 0.000
osteosarcoma -1.711 0.000
astrocytoma -1.100 0.027
diabetes mellitus -1.100 0.003

Synonym

Accession P60660 P16475 P24572 P24573 Q12790 Q561V9 Q6IAZ0 Q6IPY5
Symbols LC17
ESMLC
LC17A
LC17B
MLC-3
MLC1SM
MLC3NM
MLC3SM
LC17-GI
LC17-NM

Gene

Gene RIF (4)

PMID Text
25010285 Interaction of HIV-1 Gag with myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6) is identified in a series of six affinity purification/mass spectrometry screens
23166591 Interaction of HIV-1 Gag with myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6) is identified in a series of six affinity purification/mass spectrometry screens
19794400 Interaction of HIV-1 Gag with myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6) is identified in a series of six affinity purification/mass spectrometry screens
19460752 Knockdown of myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHF      1 - 70
LPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCIN     71 - 140
YEAFVRHILSG                                                               141 - 151
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22114352 2012 A new role for the architecture of microvillar actin bundles in apical retention of membrane proteins.
More...