Property Summary

NCBI Gene PubMed Count 25
PubMed Score 68.90
PubTator Score 21.60

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma -1.100 2.7e-02
diabetes mellitus -1.100 2.9e-03
osteosarcoma -1.711 2.8e-06
psoriasis -2.700 6.5e-06

Gene RIF (5)

AA Sequence

MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHF      1 - 70
LPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCIN     71 - 140
YEAFVRHILSG                                                               141 - 151
//

Text Mined References (34)

PMID Year Title