Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MNSPCDRLQQFIQVLLEESWSFPSFANTLHWPENLLSYIDELVWQGSLQNFHQHEVRFDKPPLRLPLTGF      1 - 70
SSLTENWSSRQAVSSRLVATAASPPAGCQAPIAFLGLKFSSLGPARKNPALCFLYDQSNSKCNTSWVKEN     71 - 140
VGCPWHWCNIHEALIRTEKGSDPMFYVNTSTGGRDGFNGFNLQISDPWDPRWASGVDGGLYEHKTFMYPV    141 - 210
AKIRIARTLKTTVTGLSDLASSIQSAEKELTSQLQPAADQAKSSRFSWLTLISEGAQLLQSTGVQNLSHC    211 - 280
FLCAALRRPPLVAVPLPTPFNYTINSSTPIPPVPKGQVPLFSDPIRHKFPFCYSTPNASWCNQTRMLTST    281 - 350
PAPPRGYFWCNSTLTKVLNSTGNHTLCLPISLIPGLTLYSQDELSHLLAWTEPRPQNKSKWAIFLPLVLG    351 - 420
ISLASSLVASGLGKGALTHSIQTSQDLSTHLQLAIEASAESLDSLQRQITTVAQVAAQNRQALDLLMAEK    421 - 490
GRTCLFLQEECCYYLNESGVVENSLQTLKKKKSSKRS                                     491 - 527
//

Text Mined References (6)

PMID Year Title
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
14557543 2003 Genomewide screening for fusogenic human endogenous retrovirus envelopes identifies syncytin 2, a gene conserved on primate evolution.
12970426 2003 Survey of human genes of retroviral origin: identification and transcriptome of the genes with coding capacity for complete envelope proteins.
12890629 2003 Characterization of the low-copy HERV-Fc family: evidence for recent integrations in primates of elements with coding envelope genes.
12853948 2003 The DNA sequence of human chromosome 7.
11689652 2001 Identification, phylogeny, and evolution of retroviral elements based on their envelope genes.