Property Summary

NCBI Gene PubMed Count 3
PubMed Score 13.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma -1.100 1.1e-12
glioblastoma multiforme -1.100 1.3e-12
invasive ductal carcinoma 1.100 1.8e-02
oligodendroglioma -1.400 6.4e-17
Pick disease -1.100 4.3e-04
psoriasis -1.300 1.9e-16

Synonym

Accession P60606
Symbols CTXN

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

AA Sequence

MSATWTLSPEPLPPSTGPPVGAGLDAEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRMPASSWTDHKE      1 - 70
ALERGQFDYALV                                                               71 - 82
//

Text Mined References (3)

PMID Year Title