1. Home
  2. Targets
  3. Cortexin-1

Tdark Cortexin-1

May mediate extracellular or intracellular signaling of cortical neurons during forebrain development.

 Comments

Property Summary

NCBI Gene PubMed Count 3
PubMed Score 12.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 6.42551146617961E-17
psoriasis 6685 1.94201065294347E-16
astrocytoma 1493 1.07251400456079E-12
glioblastoma multiforme 347 1.2794065315816E-12
Pick disease 1893 4.33121097788889E-4
invasive ductal carcinoma 2950 0.0182699093329269
Disease Target Count Z-score Confidence
Rectum cancer 12 3.653 1.8
Proctitis 11 3.224 1.6
Corneal edema 14 3.037 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma -1.100 0.000
glioblastoma multiforme -1.100 0.000
oligodendroglioma -1.400 0.000
Pick disease -1.100 0.000
invasive ductal carcinoma 1.100 0.018
psoriasis -1.300 0.000

Synonym

Accession P60606
Symbols CTXN

Gene

CTXN1

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid

 GO Component (1)

 Compartment GO Term (8)

 HCA RNA Cell Line (55)

See all...

Pathway (1)

 UniProt Keyword (5)

AA Sequence 

MSATWTLSPEPLPPSTGPPVGAGLDAEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRMPASSWTDHKE      1 - 70
ALERGQFDYALV                                                               71 - 82
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8336151 1993 Identification of cortexin: a novel, neuron-specific, 82-residue membrane protein enriched in rodent cerebral cortex.