Property Summary

NCBI Gene PubMed Count 3
PubMed Score 12.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 6.42551146617961E-17
psoriasis 6685 1.94201065294347E-16
astrocytoma 1493 1.07251400456079E-12
glioblastoma multiforme 347 1.2794065315816E-12
Pick disease 1893 4.33121097788889E-4
invasive ductal carcinoma 2950 0.0182699093329269
Disease Target Count Z-score Confidence
Rectum cancer 12 3.653 1.8
Proctitis 11 3.224 1.6
Corneal edema 14 3.037 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma -1.100 0.000
glioblastoma multiforme -1.100 0.000
oligodendroglioma -1.400 0.000
Pick disease -1.100 0.000
invasive ductal carcinoma 1.100 0.018
psoriasis -1.300 0.000

Synonym

Accession P60606
Symbols CTXN

Gene

  Ortholog (7)

AA Sequence

MSATWTLSPEPLPPSTGPPVGAGLDAEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRMPASSWTDHKE      1 - 70
ALERGQFDYALV                                                               71 - 82
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8336151 1993 Identification of cortexin: a novel, neuron-specific, 82-residue membrane protein enriched in rodent cerebral cortex.