Property Summary

NCBI Gene PubMed Count 31
Grant Count 66
R01 Count 30
Funding $9,374,902.26
PubMed Score 12.73
PubTator Score 36.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.096 0.008
psoriasis -1.100 0.000
osteosarcoma -2.004 0.000
astrocytoma 1.100 0.006
glioblastoma 1.100 0.014
medulloblastoma, large-cell 1.300 0.000
group 3 medulloblastoma 1.200 0.005
acute myeloid leukemia 1.400 0.008
ovarian cancer 1.700 0.000

Synonym

Accession P60604 A6NMQ7 A8K3L4 D3DSL7 P56554
Symbols UBC7

Gene

PDB

2LXP   3H8K   4LAD   2CYX   2KLY  

Gene RIF (7)

PMID Text
24366945 These results reveal an unanticipated mode of Ube2g2 self-association that allows Ube2g2 to effectively engage two ubiquitins to specifically synthesize Lys48-linked ubiquitin chains.
21127063 The presence of the AUP1-Ube2g2 complex at LDs provides a direct molecular link between LDs and the cellular ubiquitination machinery.
21098018 Lys-48-linked polyubiquitin chains may be designed to bind certain proteins like Ube2g2 such that the terminal ubiquitin subunit carrying the reactive Lys-48 side chain can be positioned properly for chain elongation regardless of chain length.
20014027 Results report the solution structure and backbone dynamics of Ube2g2 solved by nuclear magnetic resonance spectroscopy.
16582478 Structural comparison of human UBE2G2 with yeast Ubc7 indicated that the overall structures are similar except for the long loop region and the C-terminal helix.
16407162 interrupting a specific E2-E3 interaction can selectively inhibit endoplasmic reticulum -associated degradation
12869571 Ubc7 mediates inositol 1,4,5-trisphosphate receptor ubiquitination and is a component of the endoplasmic reticulum-associated degradation pathway

AA Sequence

MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPK      1 - 70
MRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDA     71 - 140
SKMWRDDREQFYKIAKQIVQKSLGL                                                 141 - 165
//

Text Mined References (33)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
24882218 2014 Unanchored K48-linked polyubiquitin synthesized by the E3-ubiquitin ligase TRIM6 stimulates the interferon-IKK? kinase-mediated antiviral response.
24366945 2014 Dimeric Ube2g2 simultaneously engages donor and acceptor ubiquitins to form Lys48-linked ubiquitin chains.
23942235 2013 Allosteric regulation of E2:E3 interactions promote a processive ubiquitination machine.
22607976 2012 STT3B-dependent posttranslational N-glycosylation as a surveillance system for secretory protein.
21628527 2011 Selective ubiquitylation of p21 and Cdt1 by UBCH8 and UBE2G ubiquitin-conjugating enzymes via the CRL4Cdt2 ubiquitin ligase complex.
21269460 2011 Initial characterization of the human central proteome.
21127063 2011 Ancient ubiquitous protein 1 (AUP1) localizes to lipid droplets and binds the E2 ubiquitin conjugase G2 (Ube2g2) via its G2 binding region.
21098018 2011 Mechanism of polyubiquitin chain recognition by the human ubiquitin conjugating enzyme Ube2g2.
More...