Property Summary

NCBI Gene PubMed Count 32
PubMed Score 15.44
PubTator Score 36.87

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia 1.400 8.4e-03
astrocytoma 1.100 6.3e-03
glioblastoma 1.100 1.4e-02
group 3 medulloblastoma 1.200 5.3e-03
medulloblastoma, large-cell 1.300 3.5e-06
Multiple myeloma 1.096 8.0e-03
osteosarcoma -2.004 1.7e-06
ovarian cancer -1.100 2.0e-04
psoriasis -1.100 4.7e-04

Gene RIF (8)

AA Sequence

MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPK      1 - 70
MRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDA     71 - 140
SKMWRDDREQFYKIAKQIVQKSLGL                                                 141 - 165
//

Text Mined References (34)

PMID Year Title