Property Summary

NCBI Gene PubMed Count 29
PubMed Score 33.61
PubTator Score 33.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Synonym

Accession P60602 A7M872 E1P5R9 E9KL28 Q3MHD5 Q5QP16 Q9CQ98 Q9H1N2 ROS modulator 1
Symbols MTGM
MTGMP
C20orf52
bA353C18.2

Gene

Gene RIF (23)

PMID Text
25824963 The rs6060566 polymorphism of the Romo-1 gene was found to be an independent risk factor for DR in Caucasians with T2DM.
25687884 High ROMO1 expression is associated with Fanconi anemia.
25673177 These results demonstrate that tumor cell invasion in response to oxidative stress is associated with Romo1 expression and the NF-kappaB signaling pathway.
25468147 Increased Romo1 expression in surgically resected NSCLC was found to be significantly associated with early recurrence and poor survival. Romo1 overexpression could be a potential adverse prognostic marker in this setting.
25374412 Genetic polymorphisms of Romo1 gene were associated with significant risk of gastric cancer.
25193023 Results demonstrate that expression of Romo1 is frequently upregulated in human glioblastomas and its elevation promotes malignant tumor progression by promoting cell cycle progression and by enhancing tumorigenicity
25044121 Romo1 may be a principal regulatory factor in the maintenance of constitutive NF-kappaB activation in tumor cells
24951318 Serum Romo1 discriminated NSCLC patients from the population without cancer with considerable sensitivity and specificity. Serum Romo1 could be a potential diagnostic biomarker for NSCLC.
24473195 data identify ROMO1 as a critical molecular switch that couples metabolic stress and mitochondrial morphology, linking mitochondrial fusion to cell survival.
24473193 that ROS modulator protein 1 (ROMO1) links ROS and mitochondrial morphology and ultrastructure by modulating cristae remodeling and mitochondrial fusion
More...

AA Sequence

MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTF      1 - 70
MAIGMGIRC                                                                  71 - 79
//

Text Mined References (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25824963 2015 The rs6060566 of the reactive oxygen species modulator 1 (Romo-1) gene affects Romo-1 expression and the development of diabetic retinopathy in Caucasians with type 2 diabetes.
25687884 2015 ROMO1 regulates RedOx states and serves as an inducer of NF-?B-driven EMT factors in Fanconi anemia.
25673177 2015 Romo1 and the NF-?B pathway are involved in oxidative stress-induced tumor cell invasion.
25468147 2015 Reactive oxygen species modulator 1 (Romo1) overexpression is an independent predictor of poor survival in NSCLC patients who undergo surgical resection.
25374412 2015 Association of Romo1 gene genetic polymorphisms with risk of gastric cancer in northwestern Chinese population.
25193023 2015 Romo1 is associated with ROS production and cellular growth in human gliomas.
25044121 2014 Constitutive NF-?B activation and tumor-growth promotion by Romo1-mediated reactive oxygen species production.
24951318 2014 Serum reactive oxygen species modulator 1 (Romo1) as a potential diagnostic biomarker for non-small cell lung cancer.
24473195 2014 ROMO1 is an essential redox-dependent regulator of mitochondrial dynamics.
More...