Property Summary

NCBI Gene PubMed Count 32
PubMed Score 39.55
PubTator Score 33.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 3.4e-05
glioblastoma 1.300 1.5e-06
group 3 medulloblastoma 1.600 8.3e-04
non primary Sjogren syndrome sicca 1.100 4.2e-02
ovarian cancer 1.600 4.1e-04
posterior fossa group B ependymoma 1.100 4.1e-05

Gene RIF (26)

AA Sequence

MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTF      1 - 70
MAIGMGIRC                                                                  71 - 79
//

Text Mined References (35)

PMID Year Title