Property Summary

NCBI Gene PubMed Count 647
PubMed Score 23652.69
PubTator Score 16378.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 5.259 2.6
Disease Target Count Z-score Confidence
Cancer 2346 7.316 3.7

Expression

Synonym

Accession P60568 P01585 IL-2
Symbols IL-2
TCGF
lymphokine

Gene

IL2

PDB

1ILM   1ILN   2B5I   2ERJ   3QAZ   1Z92   1IRL   1M47   1M48   1M49   1M4A   1M4B   1M4C   1NBP   1PW6   1PY2   1QVN   3INK   3QB1   4NEJ   4NEM  

  Ortholog (7)

 GWAS Trait (1)

 HCA RNA Cell Line (1)

Gene RIF (683)

PMID Text
26952371 After 4 weeks of star fruit juice consumption, a significant reduction in NO, TNF-alpha and IL-23 was found; however, there was no change in IL-2.
26771888 Single Nucleotide Polymorphisms in interleukin 2 gene involved in the immune response are generally not associated with intraprostatic inflammation in men without a Prostate cancer diagnosis.
26751822 Production of IL2 in follicular fluid lymphocytes of PCOS patients was significantly higher than that in controls. IL2 concentration in follicular fluid of PCOS patients was significantly higher than that in controls.
26722428 IL-2 may be involved in the pathogenesis of recurrent oral ulcer.
26609634 The polymorphisms in IL-2 and IL-10 genes may contribute to basal-cell carcinoma (BCC) susceptibility and influence the clinical course of BCC in polish population.
26561569 Triple costimulation via CD80, 4-1BB, and CD83 ligand elicits the long-term growth of Vgamma9Vdelta2 T cells in low levels of IL-2.
26498252 Moxifloxacin restored IL-2 expression and T-cell proliferation in the presence of LPS by blocking p38 MAPK
26492563 TIM-3 is a negative regulator of TCR-function by attenuating activation signals mediated by CD3/CD28 co-stimulation.
26440592 level of expression correlates with pain response in subjects with intervertebral disc disorders
26396258 Data show that JAK/STAT signaling inhibition is potentiated by Bcl-xL (B-cell lymphoma-extra large) blockade in interleukin 2 (IL-2) dependent adult T-cell leukemia cells.
More...

AA Sequence

MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKA      1 - 70
TELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNR     71 - 140
WITFCQSIISTLT                                                             141 - 153
//

Text Mined References (647)

PMID Year Title
26952371 Consumption of star fruit juice on pro-inflammatory markers and walking distance in the community dwelling elderly.
26771888 2016 Key genes involved in the immune response are generally not associated with intraprostatic inflammation in men without a prostate cancer diagnosis: Results from the prostate cancer prevention trial.
26751822 2016 Differential Expression Profile of Immunological Cytokines in Local Ovary in Patients with Polycystic Ovarian Syndrome: analysis by Flow Cytometry.
26722428 2015 Microarray analysis of potential genes in the pathogenesis of recurrent oral ulcer.
26609634 2016 Clinical significance of IL-2 and IL-10 gene polymorphisms and serum levels in patients with basal-cell carcinoma.
26561569 2016 Triple costimulation via CD80, 4-1BB, and CD83 ligand elicits the long-term growth of V?9V?2 T cells in low levels of IL-2.
26498252 2016 A systemic defect in Toll-like receptor 4 signaling increases lipopolysaccharide-induced suppression of IL-2-dependent T-cell proliferation in COPD.
26492563 2015 TIM-3 Suppresses Anti-CD3/CD28-Induced TCR Activation and IL-2 Expression through the NFAT Signaling Pathway.
26440592 2015 Exploratory study for identifying systemic biomarkers that correlate with pain response in patients with intervertebral disc disorders.
26396258 2015 Selective targeting of JAK/STAT signaling is potentiated by Bcl-xL blockade in IL-2-dependent adult T-cell leukemia.
More...