Property Summary

NCBI Gene PubMed Count 56
Grant Count 5
R01 Count 5
Funding $202,813.73
PubMed Score 203.78
PubTator Score 28.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.237 0.003
medulloblastoma, large-cell -1.100 0.001
subependymal giant cell astrocytoma -1.155 0.049
spina bifida -1.099 0.049
ovarian cancer -2.400 0.000

Gene RIF (23)

PMID Text
26284781 Using X-ray crystallography and NMR spectroscopy, the structural transition centered on the C-terminus of GATE-16 protein was identified.
25181299 describe a protocol for the reconstituted conjugation systems for mammalian Atg8 homologs in vitro using purified recombinant Atg proteins and liposomes.
24747438 Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3.
24269818 these results suggest that TRPML3 plays a role in autophagosome maturation through the interaction with GATE16, by providing Ca(2+) in the fusion process.
23891751 low GABARAPL2/GATE-16 expression is associated with an immature myeloid leukemic phenotype and these proteins are necessary for neutrophil differentiation of APL cells
23112293 Legionella pneumophila could interfere with autophagy by using the bacterial effector protein RavZ to directly uncouple Atg8 proteins attached to phosphatidylethanolamine on autophagosome membranes. [RavZ]
23043107 ATG8 proteins act as scaffolds for assembly of the ULK complex at the phagophore
22959883 Results showed that the mRNA and protein levels of GABARAPL1 and GATE-16 were decreased in the cerebellum of multiple system atrophy relative to controls
22885598 Binding of the Atg1/ULK1 kinase to the ubiquitin-like protein Atg8 regulates autophagy
22421968 TP53INP1, a tumor suppressor, interacts with LC3 and ATG8-family proteins through the LC3-interacting region (LIR) and promotes autophagy-dependent cell death.
More...

AA Sequence

MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQL      1 - 70
PSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF                            71 - 117
//

Text Mined References (64)

PMID Year Title
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26284781 2015 Conformational Polymorphism in Autophagy-Related Protein GATE-16.
26040720 2015 Regulation of endoplasmic reticulum turnover by selective autophagy.
25416956 2014 A proteome-scale map of the human interactome network.
25181299 2014 In vitro assays of lipidation of Mammalian Atg8 homologs.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24747438 2014 Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3.
24668264 2014 Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures.
24269818 2014 The Ca2+ channel TRPML3 specifically interacts with the mammalian ATG8 homologue GATE16 to regulate autophagy.
More...