Property Summary

NCBI Gene PubMed Count 60
PubMed Score 234.19
PubTator Score 28.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell -1.100 6.0e-04
ovarian cancer -2.400 5.8e-09
spina bifida -1.099 4.9e-02
subependymal giant cell astrocytoma -1.155 4.9e-02
Waldenstrons macroglobulinemia 1.237 3.1e-03

Protein-protein Interaction (1)

Gene RIF (26)

AA Sequence

MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQL      1 - 70
PSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF                            71 - 117
//

Text Mined References (68)

PMID Year Title