Property Summary

NCBI Gene PubMed Count 44
Grant Count 40
R01 Count 18
Funding $2,045,170.11
PubMed Score 260.87
PubTator Score 496.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 3.200 0.000
glioblastoma 1.400 0.000
osteosarcoma 1.208 0.000
group 3 medulloblastoma 1.200 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
medulloblastoma, large-cell 1.100 0.000
pediatric high grade glioma 1.100 0.000
posterior fossa group A ependymoma 1.100 0.000
lung adenocarcinoma 1.093 0.000
ovarian cancer 2.100 0.000

Gene RIF (25)

PMID Text
27041735 mutual regulatory mechanisms exist between PP4 and SAF-A. Interactions between PP4 and SAF-A played a role in prometaphase/metaphase transition.
25927939 These data suggested a potential role of PP4C in tumor progression.
25320307 Stathmin plays an essential role of in Merkel cell polyomavirus small tumor antigen-mediated microtubule destabilization and cell motility and this process is regulated by cellular phosphatase catalytic subunit of protein phosphatase 4.
24711418 PP4 and Wip1 are differentially required to counteract the p53-dependent cell cycle arrest in G1 and G2, by antagonizing early or late p53-mediated responses, respectively
24265311 Data indicate that the major phosphatase responsible for dephosphorylation of of BAF Ser-4 to be protein phosphatase 4 catalytic subunit.
23966160 Recombinant gamma-tubulin can be phosphorylated by Cdk1-cyclin B or Brsk1 and dephosphorylated by Ppp4c-R2-R3A in vitro.
23830831 PP4c is a key regulator of cortical development that changes the orientation of progenitor division responsible for the transition between symmetric and asymmetric cell division.
23671329 Results show PP4C as a fostriecin-sensitive phosphatase and demonstrate that the suppression of PP4C triggers mitotic slippage/apoptosis.
23084358 PP4R1 and PP4c Cooperate to Catalyze IKK Dephosphorylation
22732494 PP4C and KAP1 are in the same epistasis group, and PP4 is involved in NHEJ-mediated DSB repair, possibly through regulating the phosphorylation status of KAP1.
More...

AA Sequence

MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGG      1 - 70
DVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVW     71 - 140
RYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTTGWGVSP    141 - 210
RGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQ    211 - 280
KDFIIFEAAPQETRGIPSKKPVADYFL                                               281 - 307
//

Text Mined References (51)

PMID Year Title
27041735 2016 Protein phosphatase 4 plays dual roles during cell proliferation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25927939 2015 High expression of protein phosphatase 4 is associated with the aggressive malignant behavior of colorectal carcinoma.
25320307 2015 Merkel cell polyomavirus small T antigen mediates microtubule destabilization to promote cell motility and migration.
25130464 2014 Leucine methylation of protein phosphatase PP4C at C-terminal is critical for its cellular functions.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24711418 2014 Distinct phosphatases antagonize the p53 response in different phases of the cell cycle.
24265311 2014 Dephosphorylation of barrier-to-autointegration factor by protein phosphatase 4 and its role in cell mitosis.
23966160 2013 Protein phosphatase 4 is phosphorylated and inactivated by Cdk in response to spindle toxins and interacts with ?-tubulin.
23830831 2013 The phosphatase PP4c controls spindle orientation to maintain proliferative symmetric divisions in the developing neocortex.
More...