Property Summary

NCBI Gene PubMed Count 48
PubMed Score 266.77
PubTator Score 496.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 1.2e-08
glioblastoma 1.100 8.1e-08
group 3 medulloblastoma 1.200 2.6e-04
lung adenocarcinoma 1.093 1.7e-08
medulloblastoma, large-cell 1.100 6.8e-05
osteosarcoma 1.208 4.2e-05
ovarian cancer 2.100 2.4e-06
pediatric high grade glioma 1.100 9.3e-08
posterior fossa group A ependymoma 1.100 2.3e-11
psoriasis 3.200 8.7e-06

Protein-protein Interaction (1)

Gene RIF (28)

AA Sequence

MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGG      1 - 70
DVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVW     71 - 140
RYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTTGWGVSP    141 - 210
RGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQ    211 - 280
KDFIIFEAAPQETRGIPSKKPVADYFL                                               281 - 307
//

Text Mined References (55)

PMID Year Title