Property Summary

NCBI Gene PubMed Count 1,611
PubMed Score 4696.10
PubTator Score 3962.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (8)

Disease Target Count
Autistic Disorder 320
Acute Megakaryocytic Leukemias 4
Adenocarcinoma 115
Adenoid Cystic Carcinoma 99
Anisometropia 16
Asthma 349
Chromosome 10q23 Deletion Syndrome 2
Craniofacial Abnormalities 147
Dermatologic disorders 65
Developmental Disabilities 20
Disease Progression 125
Dysplastic gangliocytoma of cerebellum (Lhermitte-Duclos) 1
Endometrial Hyperplasia 5
Endometrial Neoplasms 50
Endometrial carcinoma 18
Familial meningioma 5
GLIOMA SUSCEPTIBILITY 2 1
Glioma 66
Hamartoma Syndrome, Multiple 9
Hemangioma 35
Hereditary Breast and Ovarian Cancer Syndrome 14
Hypertensive disease 193
IGA Glomerulonephritis 454
Insulin Resistance 50
Intellectual disability 573
Language Development Disorders 9
Leukemia 88
Lipoma 19
Long QT syndrome 53
Lung Neoplasms 171
Lymphoma 57
MELANOMA, CUTANEOUS MALIGNANT, 1 4
Malignant neoplasm of prostate 67
Mammary Neoplasms 410
Mediastinal Germ Cell Tumor 2
Meningioma 27
Motor Skills Disorders 6
Myocardial Reperfusion Injury 34
Neoplasm Invasiveness 127
Neoplasm Metastasis 138
Neoplastic Syndromes, Hereditary 48
PTEN Hamartoma Tumor Syndrome 1
Pancreatic Neoplasm 79
Polydactyly 93
Prostatic Intraepithelial Neoplasias 11
Prostatic Neoplasms 471
Proteus-Like Syndrome (disorder) 1
Pten Hamartoma Tumor Syndrome With Granular Cell Tumor 1
Renal Cell Carcinoma 199
Reperfusion Injury 84
Sezary Syndrome 26
Small cell carcinoma of lung 45
Squamous cell carcinoma of the head and neck 24
Thyroid cancer, follicular 7
Vater Association With Macrocephaly And Ventriculomegaly 1
nasopharyngeal carcinoma 1056
ovarian neoplasm 97
Disease Target Count P-value
non-small cell lung cancer 2798 2.73579972442101E-13
juvenile dermatomyositis 1189 9.83857937080975E-13
lung adenocarcinoma 2714 1.27986431284015E-12
atypical teratoid / rhabdoid tumor 4369 2.63088666317156E-7
acute quadriplegic myopathy 1157 3.4138884849822E-7
adult high grade glioma 2148 2.63314311508568E-5
ovarian cancer 8492 5.02612480105887E-5
glioblastoma 5572 8.41728591053212E-5
invasive ductal carcinoma 2950 2.81439142942935E-4
tuberculosis 1563 2.93197855787629E-4
osteosarcoma 7933 6.28396555162409E-4
medulloblastoma, large-cell 6234 6.37966762869963E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00283239129285647
pancreatic cancer 2300 0.0263395057405447
oligodendroglioma 2849 0.0447822938197194
Disease Target Count Z-score Confidence
Head and neck squamous cell carcinoma 12 0.0 5.0
Prostate cancer 172 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2346 7.174 3.6
Disease Target Count
Glioma 2 1

Expression

  Differential Expression (16)

Disease log2 FC p
oligodendroglioma -1.400 0.045
osteosarcoma -2.198 0.001
glioblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.400 0.001
juvenile dermatomyositis 1.165 0.000
acute quadriplegic myopathy 1.171 0.000
pancreatic ductal adenocarcinoma liver m... -1.018 0.003
tuberculosis 1.400 0.000
non-small cell lung cancer -1.140 0.000
adult high grade glioma -1.500 0.000
lung adenocarcinoma -1.500 0.000
invasive ductal carcinoma -1.600 0.000
ovarian cancer -1.400 0.000
Breast cancer -1.300 0.000
pancreatic cancer 1.100 0.026

Synonym

Accession P60484 B2R904 F2YHV0 O00633 O02679 Q6ICT7
Symbols BZS
DEC
CWS1
GLM2
MHAM
TEP1
MMAC1
PTEN1
10q23del

Gene

PDB

2KYL   4O1V   1D5R   5BUG   5BZX   5BZZ  

  Ortholog (13)

Gene RIF (1549)

PMID Text
27049078 The proposed quantitative method of PTEN expression assessment creates an alternative to currently available subjective methods and forms the basis for inter-case and inter-tissue comparisons.
27010857 findings demonstrate that the BRD7/miR-141/PTEN/AKT axis has critical roles in the progression of NPC and provide some promising targets for the diagnosis and treatment of NPC.
26869029 PTEN-dependent endosome maturation through phosphoregulation of Rab7 as an important route of controlling EGFR signalling.
26823866 PTEN gene polymorphisms might relate to liver cancer risk.
26791485 MiR-148a-3p could directly bind to the PTEN 3'-UTR.
26787927 Profilin interacts with a protein phosphatase, phosphatase and tension homologue (PTEN), and protects it from degradation.
26787105 This study suggests a high frequency of miR-21 overexpression and aberrant promoter methylation in down-regulation of PTEN expression in colorectal carcinoma. Loss of PTEN may be a prognostic factor for patients with CRC.
26782378 These results suggest that in the progression of renal aging, high expression of TIMP-1 up-regulates PTEN expression indicating that PTEN and TIMP-1 are involved in the aging-associated impairment of renal angiogenesis
26772880 This study indicated that miR-367 negatively regulates PTEN and promotes proliferation and invasion of HCC cells. Thus, miR-367 may represent a potential therapeutic target for HCC intervention.
26750720 our results indicate that miR-181A expression is associated with CRC patients with late liver metastases through PTEN/AKT signaling.
More...

AA Sequence

MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNL      1 - 70
CAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLL     71 - 140
HRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFSGGT    141 - 210
CNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFI    211 - 280
PGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKT    281 - 350
VEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV                     351 - 403
//

Text Mined References (1619)

PMID Year Title
27049078 A novel quantitative method of pten expression assessment in tumor tissue.
27010857 2016 miR-141 is involved in BRD7-mediated cell proliferation and tumor formation through suppression of the PTEN/AKT pathway in nasopharyngeal carcinoma.
26869029 2016 PTEN modulates EGFR late endocytic trafficking and degradation by dephosphorylating Rab7.
26823866 2015 Association of PTEN gene polymorphisms with liver cancer risk.
26791485 2016 miR-148a-3p overexpression contributes to glomerular cell proliferation by targeting PTEN in lupus nephritis.
26787927 2016 Profilin-PTEN interaction suppresses NF-?B activation via inhibition of IKK phosphorylation.
26787105 2016 The prognostic effect of PTEN expression status in colorectal cancer development and evaluation of factors affecting it: miR-21 and promoter methylation.
26782378 2015 Effect of TIMP1 transfection on PTEN expression in human kidney proximal tubular cells.
26772880 2016 miR-367 promotes proliferation and invasion of hepatocellular carcinoma cells by negatively regulating PTEN.
26750720 2016 Expression and mechanism of microRNA-181A on incidence and survival in late liver metastases of colorectal cancer.
More...