Property Summary

NCBI Gene PubMed Count 31
PubMed Score 2.73
PubTator Score 16.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.400 2.1e-04
glioblastoma 1.300 6.0e-04
hepatocellular carcinoma -1.300 2.7e-02
osteosarcoma -2.112 2.7e-05
ovarian cancer -1.300 3.3e-05
pancreatic ductal adenocarcinoma liver m... -1.416 7.2e-03
psoriasis 2.500 9.3e-06

Protein-protein Interaction (5)

Gene RIF (7)

AA Sequence

MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGP      1 - 70
VPVLVMSLLFIASVFMLHIWGKYTRS                                                 71 - 96
//

Text Mined References (42)

PMID Year Title