Property Summary

NCBI Gene PubMed Count 28
PubMed Score 1.18
PubTator Score 16.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
hepatocellular carcinoma -1.300 0.027
psoriasis 2.500 0.000
osteosarcoma -2.112 0.000
glioblastoma 1.300 0.001
pancreatic ductal adenocarcinoma liver m... -1.416 0.007
ovarian cancer -1.300 0.000
dermatomyositis 1.400 0.000

Synonym

Accession P60468 P38390 P38391 Q6IBC1
Symbols

Gene

Gene RIF (6)

PMID Text
24882410 Sec61beta overexpression increased tight junction modulation rates, in conjunction with enhanced delivery of claudin-4 from and to plasma membranes.
23037926 These data confirm that the exocyst is preferentially involved in basolateral protein translation and translocation, and may well act through the phosphorylation of Sec61beta.
22710939 Sec61beta-KD cells also exhibited altered ATP7A cellular distribution.
21255561 SEC61beta and its autoantibody as biomarkers for colorectal cancer
20937808 Sec61beta function provides an alternative pathway for nuclear transport that can be utilized by membrane-embedded proteins such as full-length EGFR.
17215517 This indicates that EGF receptors are trafficked from the endoplasmic reticulum to the nucleus by a novel pathway that involves the Sec61 translocon.

AA Sequence

MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGP      1 - 70
VPVLVMSLLFIASVFMLHIWGKYTRS                                                 71 - 96
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24882410 2014 Sec61? regulates barrier functions of tight junction through expression of claudin-4 in Madin-Darby canine kidney cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23874384 2013 Genetics of callous-unemotional behavior in children.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23037926 2012 Exocyst Sec10 is involved in basolateral protein translation and translocation in the endoplasmic reticulum.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22710939 2012 Sec61? controls sensitivity to platinum-containing chemotherapeutic agents through modulation of the copper-transporting ATPase ATP7A.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22375059 2012 Different effects of Sec61?, Sec62 and Sec63 depletion on transport of polypeptides into the endoplasmic reticulum of mammalian cells.
More...