Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Synonym

Accession P60411 A2RRG1 A6NIR9 Q70LJ1
Symbols KAP10.11
KAP18.11
KRTAP18-11
KRTAP18.11

Gene

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MAASTMSIRSSAYSDSWQVDDCPESCCEPPCCATSCCAPAPCLTLVCTPVSRVSSPCCQVTCEPSPCQSG      1 - 70
CTSSCTPSCCQQSSCQPAYCTSSPCQQACCVPVCCKPVCCVPVCCGASSCCQQSSYQPACCASSSCQPAC     71 - 140
CVPVCCKPVCCAPTCSEDSYSCCQQSSCQPACCTSSPCQQSYCVPVCCKPVCCKPICCVPVCSGASSLCC    141 - 210
QQSGCQPACCTTSCCRPSSSVSLLCRPVCRPACCVPVSSCCAPTSSRQPSYCRQASCVSLLCRPVCSRPA    211 - 280
CYSFSSGQKSSC                                                              281 - 292
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15028290 2004 A cluster of 21 keratin-associated protein genes within introns of another gene on human chromosome 21q22.3.
14962103 2004 Hair keratin associated proteins: characterization of a second high sulfur KAP gene domain on human chromosome 21.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10830953 2000 The DNA sequence of human chromosome 21.