Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 2.0e-03
psoriasis 6694 3.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

AA Sequence

MADACCTRTYVIAASTMSVCSSDVGHVSRVSSPSTCTGSSWQVDNCQESCCEPRSCASSCCTPSCCAPAP      1 - 70
CLALVCAPVSCEPSPCQSGCTDSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKSNCCKPVCCVSICSG     71 - 140
ASSPCCQQSSCQSACCTFSPCQQACCVPICCKPICCVPVCSGASSLCCQKSSCQPACCTTSCCRPSSSVS    141 - 210
LLCRPVCRPACCVPVPSCCVPASSCQPSCCHPASCLSFLCRPACSRLAC                         211 - 259
//

Text Mined References (9)

PMID Year Title