Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Synonym

Accession P60371
Symbols KAP10.6
KAP18.6
KRTAP18-6
KRTAP18.6

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MAASTMSVCSSDLSYGSRVCLPGSCDSCSDSWQVDDCPESCCEPPCCAPAPCLSLVCTPVSRVSSPCCPV      1 - 70
TCEPSPCQSGCTSSCTPSCCQQSSCQLACCASSPCQQACCVPVCCKTVCCKPVCCVSVCCGDSSCCQQSS     71 - 140
CQSACCTSSPCQQACCVPVCCKPVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCTSSCTPSCCQ    141 - 210
QSSCQPTCCTSSPCQQACCVPVCCVPVCCVPTCSEDSSSCCQQSSCQPACCTSSPCQHACCVPVCSGAST    211 - 280
SCCQQSSCQPACCTASCCRPSSSVSLLCHPVCKSTCCVPVPSCGASASSCQPSCCRTASCVSLLCRPMCS    281 - 350
RPACYSLCSGQKSSC                                                           351 - 365
//

Text Mined References (5)

PMID Year Title
15028290 2004 A cluster of 21 keratin-associated protein genes within introns of another gene on human chromosome 21q22.3.
14962103 2004 Hair keratin associated proteins: characterization of a second high sulfur KAP gene domain on human chromosome 21.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359730 2002 Characterization of a first domain of human high glycine-tyrosine and high sulfur keratin-associated protein (KAP) genes on chromosome 21q22.1.
10830953 2000 The DNA sequence of human chromosome 21.