Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.11
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
psoriasis 6,685

Synonym

Accession P60370 Q0VAR7 Q0VAR8 Q70LJ3
Symbols KAP10.5
KAP18-5
KAP18.5
KRTAP10.5
KRTAP18-5
KRTAP18.1
KRTAP18.5

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MAACTMSVCSSACSDSWRVDDCPESCCEPPCGTAPCLTLVCTPVSCVSSPCCQAACEPSPCQSGCTSSCT      1 - 70
PSCCQPACCASSPCQQACCVPVCCKPVCCLPTCSKDSSSCCQQSSCQPTCCASSSCQQSCCVPVCCKPVC     71 - 140
CVPTCSEDSSSCCQHSSCQPTCCTSSPCQQSCYVPVCCKPVCFKPICCVPVCSGASTSCCQQSSCQPACC    141 - 210
TTSCCRPSSSVSLLCRPICRPACCVPISSCCAPASSYQASCCRPASCVSLLCRPACSRLAC             211 - 271
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15028290 2004 A cluster of 21 keratin-associated protein genes within introns of another gene on human chromosome 21q22.3.
14962103 2004 Hair keratin associated proteins: characterization of a second high sulfur KAP gene domain on human chromosome 21.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359730 2002 Characterization of a first domain of human high glycine-tyrosine and high sulfur keratin-associated protein (KAP) genes on chromosome 21q22.1.
10830953 2000 The DNA sequence of human chromosome 21.