Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Synonym

Accession P60331 Q0VAR0 Q0VAR1
Symbols KAP10.1
KAP18-1
KAP18.1
KRTAP10.1
KRTAP18-1
KRTAP18.1

Gene

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
23702583 hair shaft cuticle-specific KRTAP10-1 protein displays characteristics similar to the hair shaft cortex-specific KRTAP2 proteins

AA Sequence

MAASTMSVCSSACSDSWQVDACPESCCEPHCCALSCCAPAPCLTLVCTPVSRVSSPCCQAACEPSPCQSG      1 - 70
CTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCLPTCSKDSSSCCQQSSCQPTCCASSSSQQS     71 - 140
CCVPVCCKPVCYVPTCSEDSSSCCQQSSCHPACCTSSPCQQACCVPVRCKPVCCKPICCVPVCSGASTSC    141 - 210
CQQSSCQPACCTTSCCRPSSSVSLLCRPVCRPACCMPVSSCCAPASSCQASCCRPASCVSLLCRPACSRP    211 - 280
AC                                                                        281 - 282
//

Text Mined References (7)

PMID Year Title
23702583 2013 Characterization of the human hair shaft cuticle-specific keratin-associated protein 10 family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15028290 2004 A cluster of 21 keratin-associated protein genes within introns of another gene on human chromosome 21q22.3.
14962103 2004 Hair keratin associated proteins: characterization of a second high sulfur KAP gene domain on human chromosome 21.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359730 2002 Characterization of a first domain of human high glycine-tyrosine and high sulfur keratin-associated protein (KAP) genes on chromosome 21q22.1.
10830953 2000 The DNA sequence of human chromosome 21.