Property Summary

NCBI Gene PubMed Count 14
PubMed Score 41.17
PubTator Score 10.07

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (9)

AA Sequence

MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPDQKRSLESSPAPERLCSFCKHNGESRAI      1 - 70
YQSHVLKDEAGRVLCPILRDYVCPQCGATRERAHTRRFCPLTGQGYTSVYSHTTRNSAGKKLVRPDKAKT     71 - 140
QDTGHRRGGGGGAGFRGAGKSEPSPSCSPSMST                                         141 - 173
//

Text Mined References (15)

PMID Year Title