Property Summary

NCBI Gene PubMed Count 12
Grant Count 5
R01 Count 5
Funding $829,449.83
PubMed Score 39.42
PubTator Score 10.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Accession P60323 Q495E5 NOS-3
Symbols NOS3
NANOS1L
ZC2HC12C

Gene

PANTHER Protein Class (2)

Gene RIF (7)

PMID Text
25904364 NANOS3 has role in the acquisition of invasiveness by human lung tumour cells and propose a new mechanism of post-transcriptional regulation of epithelial-mesenchymal transition.
25054146 an inactivating missense mutation in NANOS3 has a role in primary ovarian insufficiency that involves increased primordial germ cell apoptosis during embryonic cell migration
24091668 NANOS3 mutation is one possible cause of primary ovarian insufficiency.
21421998 NANOS3 modulates essential aspects of human germ cell development perhaps during the cell cycle.
19565640 Report for the first time analysis of the NANOS3 gene in infertile males.
17418157 Observational study of genotype prevalence. (HuGE Navigator)
17418157 Mutations in NANOS3 exons are rare in both Chinese and Caucasian women with premature ovarian failure.

AA Sequence

MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPDQKRSLESSPAPERLCSFCKHNGESRAI      1 - 70
YQSHVLKDEAGRVLCPILRDYVCPQCGATRERAHTRRFCPLTGQGYTSVYSHTTRNSAGKKLVRPDKAKT     71 - 140
QDTGHRRGGGGGAGFRGAGKSEPSPSCSPSMST                                         141 - 173
//

Text Mined References (13)

PMID Year Title
25904364 2015 The human NANOS3 gene contributes to lung tumour invasion by inducing epithelial-mesenchymal transition.
25054146 2014 Homozygous inactivating mutation in NANOS3 in two sisters with primary ovarian insufficiency.
24736845 2014 Structural basis for the Nanos-mediated recruitment of the CCR4-NOT complex and translational repression.
24091668 2013 A NANOS3 mutation linked to protein degradation causes premature ovarian insufficiency.
22899867 2012 Analysis of meiosis regulators in human gonads: a sexually dimorphic spatio-temporal expression pattern suggests involvement of DMRT1 in meiotic entry.
21421998 2011 NANOS3 function in human germ cell development.
19565640 2009 NANOS3 gene mutations in men with isolated sterility phenotype.
17418157 2007 Mutation analysis of NANOS3 in 80 Chinese and 88 Caucasian women with premature ovarian failure.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
More...