Property Summary

NCBI Gene PubMed Count 65
PubMed Score 32.20
PubTator Score 42.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Adenocarcinoma of lung 142 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 2.3e-04
lung cancer 4740 3.1e-04
Multiple myeloma 1332 3.3e-04
Waldenstrons macroglobulinemia 765 8.2e-04
group 3 medulloblastoma 4104 9.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Connective tissue disease 62 0.0 3.0

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.100 9.5e-03
lung cancer 1.300 3.1e-04
Multiple myeloma 1.787 3.3e-04
ovarian cancer -1.600 2.3e-04
Waldenstrons macroglobulinemia 1.434 8.2e-04

Protein-protein Interaction (8)

Gene RIF (24)

AA Sequence

MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHAL      1 - 70
REKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYE     71 - 140
CGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQ    141 - 210
RTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKV    211 - 280
IQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQC    281 - 350
ISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAM    351 - 420
NIEKKLNQNSRSEAPNWATQDSGFY                                                 421 - 445
//

Text Mined References (82)

PMID Year Title