Property Summary

NCBI Gene PubMed Count 59
Grant Count 27
R01 Count 23
Funding $2,602,020.15
PubMed Score 28.05
PubTator Score 42.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.434 0.001
Multiple myeloma 1.787 0.000
lung cancer 1.300 0.000
sonic hedgehog group medulloblastoma 1.200 0.000
ovarian cancer -1.600 0.000

 GWAS Trait (1)

Gene RIF (25)

PMID Text
25400724 High eIF3e expression may contribute to tumor progression and predict poor prognosis in colon cancer.
24736843 40S ribosome loading imparts a phosphorylation mark on the cap-binding eIF4F complex that regulates selective mRNA translation and is synchronized by a specific eIF3 subunit
24481065 Int6/eIF3e is essential for proliferation and survival of human glioblastoma cells.
24092755 eukaryotic initiation factor 4G (eIF4G) protein binds to eIF3c, -d, and -e to promote mRNA recruitment to the ribosome.
23478175 IL-6 and IL-8 are HIF2alpha controlled cytokines for angiogenesis particularly in endothelial cells.
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 3 subunit E protein (EIF3E), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 3 subunit E protein (EIF3E), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 3 subunit E protein (EIF3E), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation initiation factor 3 subunit E protein (EIF3E), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22960363 Our findings indicate that Int6 act as a hypoxia-independent master switch of angiogenesis in neuronal cells
More...

AA Sequence

MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHAL      1 - 70
REKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYE     71 - 140
CGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQ    141 - 210
RTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKV    211 - 280
IQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQC    281 - 350
ISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAM    351 - 420
NIEKKLNQNSRSEAPNWATQDSGFY                                                 421 - 445
//

Text Mined References (76)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25400724 2014 Overexpression of eIF3e is correlated with colon tumor development and poor prognosis.
25064007 2014 A genome-wide association study identifies susceptibility loci for ossification of the posterior longitudinal ligament of the spine.
24736843 2014 Coupling 40S ribosome recruitment to modification of a cap-binding initiation factor by eIF3 subunit e.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24481065 2014 Int6/eIF3e is essential for proliferation and survival of human glioblastoma cells.
More...