Property Summary

NCBI Gene PubMed Count 72
Grant Count 396
R01 Count 204
Funding $74,416,559.93
PubMed Score 704.61
PubTator Score 724.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.446 0.000
astrocytic glioma -1.200 0.003
non-small cell lung cancer 1.261 0.000
intraductal papillary-mucinous neoplasm ... 1.300 0.001
lung cancer 1.700 0.000
lung adenocarcinoma 1.037 0.000
ovarian cancer 3.400 0.000
Breast cancer 1.300 0.000

Synonym

Accession P60174 B7Z5D8 D3DUS9 P00938 Q6FHP9 Q6IS07 Q8WWD0 Q96AG5 TIM
Symbols TIM
TPI
TPID
HEL-S-49

Gene

PANTHER Protein Class (1)

PDB

2IAM   2IAN   1KLG   1KLU   4E41   1HTI   1WYI   2JK2   2VOM   4BR1   4POC   4POD   4UNK   4UNL   4ZVJ  

 IMPC Term (1)

Gene RIF (33)

PMID Text
27031109 our findings are the first to identify, to our knowledge, a functional synaptic defect in TPI deficiency derived from molecular changes in the TPI dimer interface.
26353595 Polyvinylpyrrolidone stabilised silver nanoparticles (60 nM; 2-6 nm diameter) selectively inhibited PfTIM with a 7-fold decrease in enzyme catalytic efficiency (K(cat)/K(m)) over hTIM.
24614897 results suggest amyloid-beta oligomers induce neuronal death by triggering methylglyoxal(MG) production; increased release of MG is a direct consequence of triosephosphate isomerase nitrotyrosination due to amyloid-beta peptide action at the 2 tyrosines associated with the catalytic center
24598263 TPI-PEP co-crystal structure, demonstrating that PEP directly binds into the catalytic pocket of TPI.
24056040 E104D mutant is highly susceptible to proteolysis, which in all likelihood contributes to the pathogenesis of enzymopathy. In addition, the proteolysis data on wild type HsTIM illustrate an asymmetric conduct of the two monomers.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of triosephosphate isomerase 1 (TPI1) expression by HIV-1 Vpr in Vpr transduced macrophages
23736541 Data suggest that exchange reactions during gluconeogenesis catalyzed by triose-phosphate isomerase and transaldolase do not differ between subjects with type 2 diabetes and control subjects under fasting or hyperglycemic conditions.
23233058 we review the relationship between modified TPI and Alzheimer disease (AD), highlighting the relevance of this protein in AD pathology
22623148 study found promoter SNPs of CKB and TPI1 were weakly associated with schizophrenia;in addition, IFNG polymorphisms were associated with schizophrenia; results suggest that IFNG and proteins affected by IFNG may play a role in the pathogenesis of schizophrenia
21698479 A proteomic approach for identification and localization of the pericellular components of chondrocytes.
More...

AA Sequence

MAEDGEEAEFHFAALYISGQWPRLRADTDLQRLGSSAMAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAK      1 - 70
VPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVF     71 - 140
GESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGT    141 - 210
GKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVD    211 - 280
IINAKQ                                                                    281 - 286
//

Text Mined References (91)

PMID Year Title
27031109 2016 Structural and Genetic Studies Demonstrate Neurologic Dysfunction in Triosephosphate Isomerase Deficiency Is Associated with Impaired Synaptic Vesicle Dynamics.
26353595 2015 Interaction of Silver Nanoparticles with Triosephosphate Isomerase from Human and Malarial Parasite (Plasmodium falciparum): A Comparative Study.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24614897 2014 Methylglyoxal produced by amyloid-? peptide-induced nitrotyrosination of triosephosphate isomerase triggers neuronal death in Alzheimer's disease.
24598263 2014 Inhibition of triosephosphate isomerase by phosphoenolpyruvate in the feedback-regulation of glycolysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24056040 2013 The E104D mutation increases the susceptibility of human triosephosphate isomerase to proteolysis. Asymmetric cleavage of the two monomers of the homodimeric enzyme.
23736541 2013 Effects of transaldolase exchange on estimates of gluconeogenesis in type 2 diabetes.
More...