Property Summary

NCBI Gene PubMed Count 16
Grant Count 1
Funding $479,049.33
PubMed Score 2.21
PubTator Score 5.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.315 0.014
Multiple myeloma 1.491 0.000
glioblastoma 2.000 0.045
osteosarcoma 2.206 0.000
pancreatic ductal adenocarcinoma liver m... -1.244 0.034
lung cancer 1.100 0.013
diabetes mellitus -1.100 0.006
adult high grade glioma 1.300 0.013
group 3 medulloblastoma 1.200 0.002
ovarian cancer 2.300 0.000

Synonym

Accession P60059 B2R4J0 P38384 Q6IB25
Symbols SSS1

Gene

PANTHER Protein Class (1)

 Grant Application (1)

Gene RIF (2)

PMID Text
24497544 Cotransin, a substrate-selective Sec61 inhibitor, traps nascent transmembrane domains in the cytosolic vestibule, permitting detailed interrogation of an early pre-integration intermediate.
18976975 Knockdown of Sec61 gamma subunit (SEC61G) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG        1 - 68
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24497544 2014 An allosteric Sec61 inhibitor traps nascent transmembrane helices at the lateral gate.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22375059 2012 Different effects of Sec61?, Sec62 and Sec63 depletion on transport of polypeptides into the endoplasmic reticulum of mammalian cells.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
16381901 2006 The LIFEdb database in 2006.
More...