Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.28
PubTator Score 5.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.300 1.3e-02
diabetes mellitus -1.100 6.0e-03
glioblastoma 1.200 7.3e-05
group 3 medulloblastoma 1.200 2.2e-03
lung cancer 1.100 1.3e-02
Multiple myeloma 1.491 2.0e-04
osteosarcoma 2.206 4.2e-04
ovarian cancer 2.300 8.8e-06
pancreatic ductal adenocarcinoma liver m... -1.244 3.4e-02
Waldenstrons macroglobulinemia 1.315 1.4e-02

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG        1 - 68
//

Text Mined References (22)

PMID Year Title