Property Summary

NCBI Gene PubMed Count 184
Grant Count 172
R01 Count 83
Funding $19,963,283.26
PubMed Score 534.75
PubTator Score 407.55

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P60033 P18582 Q5U0J6
Symbols S5.7
CVID6
TAPA1
TSPAN28

Gene

PDB

1G8Q   1IV5   2AVZ   3X0E   5DFV   5DFW  

Gene RIF (191)

PMID Text
26926492 CD81 expression was lower in systemic sclerosis patients compared to controls independent of disease duration.
26498453 Results suggest that the CD81 antigen (CD81) expressed by B cells has differential effects on B cell proliferation or apoptosis according to Epstein-Barr virus (EBV) infection and the expression level of CD81.
26195630 LDLR was not required for the degradation of CD81 by PCSK9, but its presence strengthened the PCSK9 effect.
26116703 Data suggest that the intramolecular 188-196 bond restricts the intrinsic conformational dynamics of D-helix of cluster of differentiation 81 (CD81)-large extracellular loop (LEL), which is essential for hepatitis C virus entry.
26111452 We demonstrate that this motif plays a role in the maturation and recycling of CD19 but in a CD81-independent manner.
25940347 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
25934191 findings suggest that homozygous CD81 rs708564 TT may be a genetic modifier for avoiding HCV infection whether as a sole single nucleotide polymorphism or combined with the CLDN1 rs893051 GG genotype
25919665 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
25760631 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
25759385 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
More...

AA Sequence

MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGA      1 - 70
VMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDA     71 - 140
NNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAI    141 - 210
VVAVIMIFEMILSMVLCCGIRNSSVY                                                211 - 236
//

Text Mined References (187)

PMID Year Title
26926492 2016 CD81 and CD48 show different expression on blood eosinophils in systemic sclerosis: new markers for disease and pulmonary inflammation?
26808496 2016 Comparative Proteomics Reveals Important Viral-Host Interactions in HCV-Infected Human Liver Cells.
26498453 2015 Pre-stimulation of CD81 expression by resting B cells increases proliferation following EBV infection, but the overexpression of CD81 induces the apoptosis of EBV-transformed B cells.
26195630 2015 Plasma Membrane Tetraspanin CD81 Complexes with Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9) and Low Density Lipoprotein Receptor (LDLR), and Its Levels Are Reduced by PCSK9.
26116703 2015 An intramolecular bond at cluster of differentiation 81 ectodomain is important for hepatitis C virus entry.
26111452 2015 Role of an arginine-lysine rich motif in maturation and trafficking of CD19.
25934191 2015 CD81 and CLDN1 polymorphisms and hepatitis C virus infection susceptibility: a case control study.
25757571 2015 Interferon-? inducible protein 6 impairs EGFR activation by CD81 and inhibits hepatitis C virus infection.
25739915 2015 A mutation in the human tetraspanin CD81 gene is expressed as a truncated protein but does not enable CD19 maturation and cell surface expression.
25701820 2015 Two conserved histidines (His490 and His621) on the E2 glycoprotein of hepatitis C virus are critical for CD81-mediated cell entry.
More...