Property Summary

Ligand Count 1
NCBI Gene PubMed Count 191
PubMed Score 534.36
PubTator Score 407.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Hepatitis C 94 4.757 2.4
Common variable immunodeficiency 101 0.0 5.0

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma 2.300 7.7e-03
autosomal dominant Emery-Dreifuss muscul... 1.383 1.5e-03
Duchenne muscular dystrophy 1.367 1.0e-09
ependymoma 1.300 4.1e-02
glioblastoma 1.300 4.9e-02
intraductal papillary-mucinous adenoma (... -1.400 2.9e-02
intraductal papillary-mucinous carcinoma... -2.400 1.9e-02
intraductal papillary-mucinous neoplasm ... -2.400 6.5e-03
juvenile dermatomyositis 1.396 9.1e-13
lung adenocarcinoma -1.100 1.0e-07
lung carcinoma -1.300 1.6e-24
oligodendroglioma 1.100 2.0e-02
ovarian cancer -1.300 6.8e-06
ulcerative colitis 1.200 2.4e-04

Gene RIF (187)

AA Sequence

MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGA      1 - 70
VMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDA     71 - 140
NNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAI    141 - 210
VVAVIMIFEMILSMVLCCGIRNSSVY                                                211 - 236
//

Text Mined References (195)

PMID Year Title