Property Summary

NCBI Gene PubMed Count 189
PubMed Score 445.42
PubTator Score 339.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
cystic fibrosis 1.500 1.8e-04
active Crohn's disease -2.109 4.1e-03
active ulcerative colitis -2.263 6.0e-03
Breast cancer -2.300 9.9e-09
breast carcinoma -1.500 9.0e-03
chronic rhinosinusitis 1.429 3.1e-02
esophageal adenocarcinoma -1.700 3.8e-02
interstitial cystitis -2.400 1.7e-03
intraductal papillary-mucinous adenoma (... -1.700 3.1e-02
intraductal papillary-mucinous carcinoma... -4.400 1.8e-03
lung cancer -1.600 7.7e-03
osteosarcoma -2.217 8.5e-04
ovarian cancer 2.700 2.1e-03
pancreatic cancer -1.900 2.2e-02
pituitary cancer -1.900 4.8e-03
primary pancreatic ductal adenocarcinoma -1.778 2.5e-02
urothelial carcinoma -1.400 2.5e-02

Gene RIF (175)

AA Sequence

MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK        1 - 68
//

Text Mined References (190)

PMID Year Title