Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
psoriasis 6,685

Synonym

Accession P60014
Symbols KAP10.10
KAP18.10
KRTAP18-10
KRTAP18.10

Gene

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MAASTMSICSSACTDSWRVVDCPESCCEPCCCAPAPSLTLVCTPVSCVSSPCCQTACEPSACQSGYTSSC      1 - 70
TTPCYQQSSCQPDCCTSSPCQQACCVPVCCVPVCCVPVCNKPVCFVPTCSESSPSCCQQSSCQPTCCTSS     71 - 140
PCQQACCVPVCSKSVCYVPVCSGASTSCCQQSSCQPACCTASCCRPSSSVSLLCHPVCKSTCCVPVPSCG    141 - 210
ASASSCQPSCCRTASCVSLLCRPVCSRPACYSLCSGQKSSC                                 211 - 251
//

Text Mined References (3)

PMID Year Title
15028290 2004 A cluster of 21 keratin-associated protein genes within introns of another gene on human chromosome 21q22.3.
14962103 2004 Hair keratin associated proteins: characterization of a second high sulfur KAP gene domain on human chromosome 21.
10830953 2000 The DNA sequence of human chromosome 21.