Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6514 3.1e-04
diabetes mellitus 1683 1.4e-03

AA Sequence

MAASTMSICSSACTDSWRVVDCPESCCEPCCCAPAPSLTLVCTPVSCVSSPCCQTACEPSACQSGYTSSC      1 - 70
TTPCYQQSSCQPDCCTSSPCQQACCVPVCCVPVCCVPVCNKPVCFVPTCSESSPSCCQQSSCQPTCCTSS     71 - 140
PCQQACCVPVCSKSVCYVPVCSGASTSCCQQSSCQPACCTASCCRPSSSVSLLCHPVCKSTCCVPVPSCG    141 - 210
ASASSCQPSCCRTASCVSLLCRPVCSRPACYSLCSGQKSSC                                 211 - 251
//

Text Mined References (3)

PMID Year Title