Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.22
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.2e-07
psoriasis 6694 1.8e-04
astrocytoma 1146 6.3e-03

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytoma -1.200 6.3e-03
osteosarcoma -2.111 1.2e-07
psoriasis -1.200 1.8e-04

Synonym

Accession P60006 G3V1Q3 Q9CXK2 Q9Y269 APC15
Symbols APC15
HSPC020
C11orf51

Gene

PDB

4UI9   5A31   5G04   5G05   5L9T   5L9U   5LCW  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (2)

AA Sequence

MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDD      1 - 70
EDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI                        71 - 121
//

Text Mined References (14)

PMID Year Title