Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.22
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.200 0.000
osteosarcoma -2.111 0.000
astrocytoma -1.200 0.006

Synonym

Accession P60006 G3V1Q3 Q9CXK2 Q9Y269 APC15
Symbols APC15
HSPC020
C11orf51

Gene

PDB

4UI9   5A31   5G04   5G05   5LCW  

Gene RIF (2)

PMID Text
23007861 APC15 is required for anaphase-promoting complex/cyclosome-bound mitotic checkpoint complex-dependent CDC20 autoubiquitylation and degradation and for timely anaphase initiation.
21926987 Anaphase promoting complex subunit 15(APC15) mediates the constant turnover of CDC20 and mitotic checkpoint protein complexes, allowing the spindle checkpoint assembly to respond to the attachment state of kinetochores.

AA Sequence

MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDD      1 - 70
EDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI                        71 - 121
//

Text Mined References (13)

PMID Year Title
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
23007861 2012 APC15 mediates CDC20 autoubiquitylation by APC/C(MCC) and disassembly of the mitotic checkpoint complex.
21926987 2011 APC15 drives the turnover of MCC-CDC20 to make the spindle assembly checkpoint responsive to kinetochore attachment.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
More...